Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 114683..115340 | Replicon | plasmid pJNE7-NDM |
Accession | NZ_CP096167 | ||
Organism | Shewanella sp. JNE7 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U3PDC3 |
Locus tag | MZ097_RS21420 | Protein ID | WP_000270043.1 |
Coordinates | 114990..115340 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | MZ097_RS21415 | Protein ID | WP_000124640.1 |
Coordinates | 114683..114985 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MZ097_RS21370 (MZ097_21375) | 110308..110736 | + | 429 | WP_000591074.1 | hypothetical protein | - |
MZ097_RS21375 (MZ097_21380) | 110793..111152 | + | 360 | WP_000422768.1 | hypothetical protein | - |
MZ097_RS21380 (MZ097_21385) | 111152..111598 | + | 447 | WP_000919345.1 | Fe3+-siderophore ABC transporter permease | - |
MZ097_RS21385 (MZ097_21390) | 111595..112113 | + | 519 | WP_000210756.1 | nitrite reductase | - |
MZ097_RS21390 (MZ097_21395) | 112113..112343 | + | 231 | WP_000972663.1 | hypothetical protein | - |
MZ097_RS21395 (MZ097_21400) | 112330..113187 | + | 858 | WP_001167032.1 | hypothetical protein | - |
MZ097_RS21400 (MZ097_21405) | 113418..113945 | + | 528 | WP_001236377.1 | thermonuclease family protein | - |
MZ097_RS21405 (MZ097_21410) | 114003..114275 | + | 273 | WP_001043047.1 | HU family DNA-binding protein | - |
MZ097_RS21410 (MZ097_21415) | 114363..114656 | + | 294 | WP_001239997.1 | chromosome segregation protein ParM | - |
MZ097_RS21415 (MZ097_21420) | 114683..114985 | - | 303 | WP_000124640.1 | XRE family transcriptional regulator | Antitoxin |
MZ097_RS21420 (MZ097_21425) | 114990..115340 | - | 351 | WP_000270043.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
MZ097_RS21425 (MZ097_21430) | 115503..116051 | + | 549 | WP_001061574.1 | transcriptional regulator | - |
MZ097_RS21430 (MZ097_21435) | 116392..116586 | + | 195 | WP_000343597.1 | hypothetical protein | - |
MZ097_RS21435 (MZ097_21440) | 116597..116968 | + | 372 | WP_000516916.1 | hypothetical protein | - |
MZ097_RS21440 (MZ097_21445) | 116961..117431 | + | 471 | WP_001281821.1 | hypothetical protein | - |
MZ097_RS21445 (MZ097_21450) | 117446..117781 | - | 336 | WP_000683476.1 | hypothetical protein | - |
MZ097_RS21450 (MZ097_21455) | 117878..118366 | + | 489 | WP_001273096.1 | DUF1643 domain-containing protein | - |
MZ097_RS21455 (MZ097_21460) | 118369..118866 | + | 498 | WP_000062185.1 | hypothetical protein | - |
MZ097_RS21460 (MZ097_21465) | 119081..119785 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | aac(3)-IId / dfrA17 / aadA5 / qacE / sul1 / blaNDM-1 / ARR-3 | - | 1..137224 | 137224 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13328.21 Da Isoelectric Point: 5.2421
>T242810 WP_000270043.1 NZ_CP096167:c115340-114990 [Shewanella sp. JNE7]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE
Download Length: 351 bp
>T242810 NZ_OW967795:2585500-2585607 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTTGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTTGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 101 a.a. Molecular weight: 11006.73 Da Isoelectric Point: 7.2036
>AT242810 WP_000124640.1 NZ_CP096167:c114985-114683 [Shewanella sp. JNE7]
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV
Download Length: 303 bp
>AT242810 NZ_OW967795:c2585450-2585387 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCT
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|