Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1403767..1403987 Replicon chromosome
Accession NC_013353
Organism Escherichia coli O103:H2 str. 12009

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag ECO103_RS06965 Protein ID WP_000170965.1
Coordinates 1403767..1403874 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1403921..1403987 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ECO103_RS06935 1399622..1400455 + 834 WP_000456459.1 peptide chain release factor N(5)-glutamine methyltransferase -
ECO103_RS06940 1400452..1400844 + 393 WP_000200392.1 invasion regulator SirB2 -
ECO103_RS06945 1400848..1401657 + 810 WP_001257044.1 invasion regulator SirB1 -
ECO103_RS06950 1401693..1402547 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
ECO103_RS06955 1402696..1402803 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1402851..1402917 + 67 NuclAT_45 - -
- 1402851..1402917 + 67 NuclAT_45 - -
- 1402851..1402917 + 67 NuclAT_45 - -
- 1402851..1402917 + 67 NuclAT_45 - -
- 1402851..1402917 + 67 NuclAT_48 - -
- 1402851..1402917 + 67 NuclAT_48 - -
- 1402851..1402917 + 67 NuclAT_48 - -
- 1402851..1402917 + 67 NuclAT_48 - -
- 1402851..1402917 + 67 NuclAT_51 - -
- 1402851..1402917 + 67 NuclAT_51 - -
- 1402851..1402917 + 67 NuclAT_51 - -
- 1402851..1402917 + 67 NuclAT_51 - -
- 1402853..1402916 + 64 NuclAT_17 - -
- 1402853..1402916 + 64 NuclAT_17 - -
- 1402853..1402916 + 64 NuclAT_17 - -
- 1402853..1402916 + 64 NuclAT_17 - -
- 1402853..1402916 + 64 NuclAT_20 - -
- 1402853..1402916 + 64 NuclAT_20 - -
- 1402853..1402916 + 64 NuclAT_20 - -
- 1402853..1402916 + 64 NuclAT_20 - -
- 1402853..1402916 + 64 NuclAT_23 - -
- 1402853..1402916 + 64 NuclAT_23 - -
- 1402853..1402916 + 64 NuclAT_23 - -
- 1402853..1402916 + 64 NuclAT_23 - -
- 1402853..1402916 + 64 NuclAT_26 - -
- 1402853..1402916 + 64 NuclAT_26 - -
- 1402853..1402916 + 64 NuclAT_26 - -
- 1402853..1402916 + 64 NuclAT_26 - -
- 1402853..1402916 + 64 NuclAT_29 - -
- 1402853..1402916 + 64 NuclAT_29 - -
- 1402853..1402916 + 64 NuclAT_29 - -
- 1402853..1402916 + 64 NuclAT_29 - -
- 1402853..1402916 + 64 NuclAT_32 - -
- 1402853..1402916 + 64 NuclAT_32 - -
- 1402853..1402916 + 64 NuclAT_32 - -
- 1402853..1402916 + 64 NuclAT_32 - -
ECO103_RS31325 1403231..1403338 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1403391..1403452 + 62 NuclAT_16 - -
- 1403391..1403452 + 62 NuclAT_16 - -
- 1403391..1403452 + 62 NuclAT_16 - -
- 1403391..1403452 + 62 NuclAT_16 - -
- 1403391..1403452 + 62 NuclAT_19 - -
- 1403391..1403452 + 62 NuclAT_19 - -
- 1403391..1403452 + 62 NuclAT_19 - -
- 1403391..1403452 + 62 NuclAT_19 - -
- 1403391..1403452 + 62 NuclAT_22 - -
- 1403391..1403452 + 62 NuclAT_22 - -
- 1403391..1403452 + 62 NuclAT_22 - -
- 1403391..1403452 + 62 NuclAT_22 - -
- 1403391..1403452 + 62 NuclAT_25 - -
- 1403391..1403452 + 62 NuclAT_25 - -
- 1403391..1403452 + 62 NuclAT_25 - -
- 1403391..1403452 + 62 NuclAT_25 - -
- 1403391..1403452 + 62 NuclAT_28 - -
- 1403391..1403452 + 62 NuclAT_28 - -
- 1403391..1403452 + 62 NuclAT_28 - -
- 1403391..1403452 + 62 NuclAT_28 - -
- 1403391..1403452 + 62 NuclAT_31 - -
- 1403391..1403452 + 62 NuclAT_31 - -
- 1403391..1403452 + 62 NuclAT_31 - -
- 1403391..1403452 + 62 NuclAT_31 - -
- 1403391..1403453 + 63 NuclAT_46 - -
- 1403391..1403453 + 63 NuclAT_46 - -
- 1403391..1403453 + 63 NuclAT_46 - -
- 1403391..1403453 + 63 NuclAT_46 - -
- 1403391..1403453 + 63 NuclAT_49 - -
- 1403391..1403453 + 63 NuclAT_49 - -
- 1403391..1403453 + 63 NuclAT_49 - -
- 1403391..1403453 + 63 NuclAT_49 - -
- 1403391..1403453 + 63 NuclAT_52 - -
- 1403391..1403453 + 63 NuclAT_52 - -
- 1403391..1403453 + 63 NuclAT_52 - -
- 1403391..1403453 + 63 NuclAT_52 - -
- 1403391..1403454 + 64 NuclAT_34 - -
- 1403391..1403454 + 64 NuclAT_34 - -
- 1403391..1403454 + 64 NuclAT_34 - -
- 1403391..1403454 + 64 NuclAT_34 - -
- 1403391..1403454 + 64 NuclAT_36 - -
- 1403391..1403454 + 64 NuclAT_36 - -
- 1403391..1403454 + 64 NuclAT_36 - -
- 1403391..1403454 + 64 NuclAT_36 - -
- 1403391..1403454 + 64 NuclAT_38 - -
- 1403391..1403454 + 64 NuclAT_38 - -
- 1403391..1403454 + 64 NuclAT_38 - -
- 1403391..1403454 + 64 NuclAT_38 - -
- 1403391..1403454 + 64 NuclAT_40 - -
- 1403391..1403454 + 64 NuclAT_40 - -
- 1403391..1403454 + 64 NuclAT_40 - -
- 1403391..1403454 + 64 NuclAT_40 - -
- 1403391..1403454 + 64 NuclAT_42 - -
- 1403391..1403454 + 64 NuclAT_42 - -
- 1403391..1403454 + 64 NuclAT_42 - -
- 1403391..1403454 + 64 NuclAT_42 - -
- 1403391..1403454 + 64 NuclAT_44 - -
- 1403391..1403454 + 64 NuclAT_44 - -
- 1403391..1403454 + 64 NuclAT_44 - -
- 1403391..1403454 + 64 NuclAT_44 - -
ECO103_RS06965 1403767..1403874 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1403921..1403987 + 67 - - Antitoxin
ECO103_RS06970 1404279..1405379 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
ECO103_RS06975 1405649..1405879 + 231 WP_001146442.1 putative cation transport regulator ChaB -
ECO103_RS06980 1406037..1406732 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
ECO103_RS06985 1406776..1407129 - 354 WP_001169666.1 DsrE/F sulfur relay family protein YchN -
ECO103_RS06990 1407314..1408708 + 1395 WP_000086212.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T24278 WP_000170965.1 NC_013353:c1403874-1403767 [Escherichia coli O103:H2 str. 12009]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T24278 NC_013353:c1403874-1403767 [Escherichia coli O103:H2 str. 12009]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT24278 NC_013353:1403921-1403987 [Escherichia coli O103:H2 str. 12009]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References