Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 1403767..1403987 | Replicon | chromosome |
| Accession | NC_013353 | ||
| Organism | Escherichia coli O103:H2 str. 12009 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | B7LGX8 |
| Locus tag | ECO103_RS06965 | Protein ID | WP_000170965.1 |
| Coordinates | 1403767..1403874 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 1403921..1403987 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECO103_RS06935 | 1399622..1400455 | + | 834 | WP_000456459.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| ECO103_RS06940 | 1400452..1400844 | + | 393 | WP_000200392.1 | invasion regulator SirB2 | - |
| ECO103_RS06945 | 1400848..1401657 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| ECO103_RS06950 | 1401693..1402547 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| ECO103_RS06955 | 1402696..1402803 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 1402851..1402917 | + | 67 | NuclAT_45 | - | - |
| - | 1402851..1402917 | + | 67 | NuclAT_45 | - | - |
| - | 1402851..1402917 | + | 67 | NuclAT_45 | - | - |
| - | 1402851..1402917 | + | 67 | NuclAT_45 | - | - |
| - | 1402851..1402917 | + | 67 | NuclAT_48 | - | - |
| - | 1402851..1402917 | + | 67 | NuclAT_48 | - | - |
| - | 1402851..1402917 | + | 67 | NuclAT_48 | - | - |
| - | 1402851..1402917 | + | 67 | NuclAT_48 | - | - |
| - | 1402851..1402917 | + | 67 | NuclAT_51 | - | - |
| - | 1402851..1402917 | + | 67 | NuclAT_51 | - | - |
| - | 1402851..1402917 | + | 67 | NuclAT_51 | - | - |
| - | 1402851..1402917 | + | 67 | NuclAT_51 | - | - |
| - | 1402853..1402916 | + | 64 | NuclAT_17 | - | - |
| - | 1402853..1402916 | + | 64 | NuclAT_17 | - | - |
| - | 1402853..1402916 | + | 64 | NuclAT_17 | - | - |
| - | 1402853..1402916 | + | 64 | NuclAT_17 | - | - |
| - | 1402853..1402916 | + | 64 | NuclAT_20 | - | - |
| - | 1402853..1402916 | + | 64 | NuclAT_20 | - | - |
| - | 1402853..1402916 | + | 64 | NuclAT_20 | - | - |
| - | 1402853..1402916 | + | 64 | NuclAT_20 | - | - |
| - | 1402853..1402916 | + | 64 | NuclAT_23 | - | - |
| - | 1402853..1402916 | + | 64 | NuclAT_23 | - | - |
| - | 1402853..1402916 | + | 64 | NuclAT_23 | - | - |
| - | 1402853..1402916 | + | 64 | NuclAT_23 | - | - |
| - | 1402853..1402916 | + | 64 | NuclAT_26 | - | - |
| - | 1402853..1402916 | + | 64 | NuclAT_26 | - | - |
| - | 1402853..1402916 | + | 64 | NuclAT_26 | - | - |
| - | 1402853..1402916 | + | 64 | NuclAT_26 | - | - |
| - | 1402853..1402916 | + | 64 | NuclAT_29 | - | - |
| - | 1402853..1402916 | + | 64 | NuclAT_29 | - | - |
| - | 1402853..1402916 | + | 64 | NuclAT_29 | - | - |
| - | 1402853..1402916 | + | 64 | NuclAT_29 | - | - |
| - | 1402853..1402916 | + | 64 | NuclAT_32 | - | - |
| - | 1402853..1402916 | + | 64 | NuclAT_32 | - | - |
| - | 1402853..1402916 | + | 64 | NuclAT_32 | - | - |
| - | 1402853..1402916 | + | 64 | NuclAT_32 | - | - |
| ECO103_RS31325 | 1403231..1403338 | - | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 1403391..1403452 | + | 62 | NuclAT_16 | - | - |
| - | 1403391..1403452 | + | 62 | NuclAT_16 | - | - |
| - | 1403391..1403452 | + | 62 | NuclAT_16 | - | - |
| - | 1403391..1403452 | + | 62 | NuclAT_16 | - | - |
| - | 1403391..1403452 | + | 62 | NuclAT_19 | - | - |
| - | 1403391..1403452 | + | 62 | NuclAT_19 | - | - |
| - | 1403391..1403452 | + | 62 | NuclAT_19 | - | - |
| - | 1403391..1403452 | + | 62 | NuclAT_19 | - | - |
| - | 1403391..1403452 | + | 62 | NuclAT_22 | - | - |
| - | 1403391..1403452 | + | 62 | NuclAT_22 | - | - |
| - | 1403391..1403452 | + | 62 | NuclAT_22 | - | - |
| - | 1403391..1403452 | + | 62 | NuclAT_22 | - | - |
| - | 1403391..1403452 | + | 62 | NuclAT_25 | - | - |
| - | 1403391..1403452 | + | 62 | NuclAT_25 | - | - |
| - | 1403391..1403452 | + | 62 | NuclAT_25 | - | - |
| - | 1403391..1403452 | + | 62 | NuclAT_25 | - | - |
| - | 1403391..1403452 | + | 62 | NuclAT_28 | - | - |
| - | 1403391..1403452 | + | 62 | NuclAT_28 | - | - |
| - | 1403391..1403452 | + | 62 | NuclAT_28 | - | - |
| - | 1403391..1403452 | + | 62 | NuclAT_28 | - | - |
| - | 1403391..1403452 | + | 62 | NuclAT_31 | - | - |
| - | 1403391..1403452 | + | 62 | NuclAT_31 | - | - |
| - | 1403391..1403452 | + | 62 | NuclAT_31 | - | - |
| - | 1403391..1403452 | + | 62 | NuclAT_31 | - | - |
| - | 1403391..1403453 | + | 63 | NuclAT_46 | - | - |
| - | 1403391..1403453 | + | 63 | NuclAT_46 | - | - |
| - | 1403391..1403453 | + | 63 | NuclAT_46 | - | - |
| - | 1403391..1403453 | + | 63 | NuclAT_46 | - | - |
| - | 1403391..1403453 | + | 63 | NuclAT_49 | - | - |
| - | 1403391..1403453 | + | 63 | NuclAT_49 | - | - |
| - | 1403391..1403453 | + | 63 | NuclAT_49 | - | - |
| - | 1403391..1403453 | + | 63 | NuclAT_49 | - | - |
| - | 1403391..1403453 | + | 63 | NuclAT_52 | - | - |
| - | 1403391..1403453 | + | 63 | NuclAT_52 | - | - |
| - | 1403391..1403453 | + | 63 | NuclAT_52 | - | - |
| - | 1403391..1403453 | + | 63 | NuclAT_52 | - | - |
| - | 1403391..1403454 | + | 64 | NuclAT_34 | - | - |
| - | 1403391..1403454 | + | 64 | NuclAT_34 | - | - |
| - | 1403391..1403454 | + | 64 | NuclAT_34 | - | - |
| - | 1403391..1403454 | + | 64 | NuclAT_34 | - | - |
| - | 1403391..1403454 | + | 64 | NuclAT_36 | - | - |
| - | 1403391..1403454 | + | 64 | NuclAT_36 | - | - |
| - | 1403391..1403454 | + | 64 | NuclAT_36 | - | - |
| - | 1403391..1403454 | + | 64 | NuclAT_36 | - | - |
| - | 1403391..1403454 | + | 64 | NuclAT_38 | - | - |
| - | 1403391..1403454 | + | 64 | NuclAT_38 | - | - |
| - | 1403391..1403454 | + | 64 | NuclAT_38 | - | - |
| - | 1403391..1403454 | + | 64 | NuclAT_38 | - | - |
| - | 1403391..1403454 | + | 64 | NuclAT_40 | - | - |
| - | 1403391..1403454 | + | 64 | NuclAT_40 | - | - |
| - | 1403391..1403454 | + | 64 | NuclAT_40 | - | - |
| - | 1403391..1403454 | + | 64 | NuclAT_40 | - | - |
| - | 1403391..1403454 | + | 64 | NuclAT_42 | - | - |
| - | 1403391..1403454 | + | 64 | NuclAT_42 | - | - |
| - | 1403391..1403454 | + | 64 | NuclAT_42 | - | - |
| - | 1403391..1403454 | + | 64 | NuclAT_42 | - | - |
| - | 1403391..1403454 | + | 64 | NuclAT_44 | - | - |
| - | 1403391..1403454 | + | 64 | NuclAT_44 | - | - |
| - | 1403391..1403454 | + | 64 | NuclAT_44 | - | - |
| - | 1403391..1403454 | + | 64 | NuclAT_44 | - | - |
| ECO103_RS06965 | 1403767..1403874 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 1403921..1403987 | + | 67 | - | - | Antitoxin |
| ECO103_RS06970 | 1404279..1405379 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| ECO103_RS06975 | 1405649..1405879 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| ECO103_RS06980 | 1406037..1406732 | + | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| ECO103_RS06985 | 1406776..1407129 | - | 354 | WP_001169666.1 | DsrE/F sulfur relay family protein YchN | - |
| ECO103_RS06990 | 1407314..1408708 | + | 1395 | WP_000086212.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4001.77 Da Isoelectric Point: 11.4779
>T24278 WP_000170965.1 NC_013353:c1403874-1403767 [Escherichia coli O103:H2 str. 12009]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T24278 NC_013353:c1403874-1403767 [Escherichia coli O103:H2 str. 12009]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT24278 NC_013353:1403921-1403987 [Escherichia coli O103:H2 str. 12009]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|