Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/Fst(toxin) |
Location | 53964..54169 | Replicon | plasmid pW208 |
Accession | NZ_CP096049 | ||
Organism | Enterococcus faecalis strain AKSZ-208 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | MZO28_RS00345 | Protein ID | WP_002387930.1 |
Coordinates | 53964..54065 (+) | Length | 34 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 54105..54169 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MZO28_RS00305 | 49233..49457 | - | 225 | WP_002395938.1 | ultraviolet resistance protein UvrA repressor UvrC | - |
MZO28_RS00310 | 49451..49765 | - | 315 | WP_010774426.1 | hypothetical protein | - |
MZO28_RS00315 | 49755..50375 | - | 621 | WP_029656234.1 | recombinase family protein | - |
MZO28_RS00320 | 50554..51237 | + | 684 | Protein_63 | IS6-like element IS1216 family transposase | - |
MZO28_RS00325 | 51301..51603 | + | 303 | WP_113795156.1 | DUF6440 family protein | - |
MZO28_RS00330 | 52029..53357 | + | 1329 | WP_033919362.1 | ultraviolet resistance protein UvrA | - |
MZO28_RS00335 | 53354..53704 | + | 351 | WP_010713025.1 | hypothetical protein | - |
MZO28_RS00340 | 53661..53873 | + | 213 | WP_002395323.1 | hypothetical protein | - |
MZO28_RS00345 | 53964..54065 | + | 102 | WP_002387930.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 54105..54169 | - | 65 | - | - | Antitoxin |
MZO28_RS00350 | 54306..54602 | + | 297 | WP_113795155.1 | type III secretion system protein PrgN | - |
MZO28_RS00355 | 54856..55638 | + | 783 | WP_002369746.1 | ParA family protein | - |
MZO28_RS00360 | 55631..55987 | + | 357 | WP_002360663.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | erm(B) / fexA / optrA / aac(6')-aph(2'') | - | 1..56246 | 56246 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 34 a.a. Molecular weight: 3731.42 Da Isoelectric Point: 4.1672
>T242732 WP_002387930.1 NZ_CP096049:53964-54065 [Enterococcus faecalis]
VKDLMSLVIAPIFVGLVLEMISRVLDEEDDSRK
VKDLMSLVIAPIFVGLVLEMISRVLDEEDDSRK
Download Length: 102 bp
>T242732 NZ_OW967003:3410609-3410794 [Escherichia coli]
GTGAAAAGTGCAGACGTGATCGCCATCCTGAAGCAGCATGGCTGGGAACATATTCGAACCCGTGGCAGTCATCATCAGTT
CCGCCACCCTGTTCATCCGGGTCTGGTGACGGTTCCGCACCCTAAAAAAGATATTAAGCCCGGTACGCTGGCGCAAATTG
GGCGTCAGGCTGGTTTAACATTTTAA
GTGAAAAGTGCAGACGTGATCGCCATCCTGAAGCAGCATGGCTGGGAACATATTCGAACCCGTGGCAGTCATCATCAGTT
CCGCCACCCTGTTCATCCGGGTCTGGTGACGGTTCCGCACCCTAAAAAAGATATTAAGCCCGGTACGCTGGCGCAAATTG
GGCGTCAGGCTGGTTTAACATTTTAA
Antitoxin
Download Length: 65 bp
>AT242732 NZ_CP096049:c54169-54105 [Enterococcus faecalis]
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|