Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-agrB/Ldr(toxin)
Location 2656782..2657001 Replicon chromosome
Accession NZ_CP095843
Organism Escherichia fergusonii strain EF21QZZ116

Toxin (Protein)


Gene name ldrD Uniprot ID A0A826RQE3
Locus tag MYF53_RS12970 Protein ID WP_000170746.1
Coordinates 2656782..2656889 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name agrB
Locus tag -
Coordinates 2656947..2657001 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MYF53_RS12945 (2652018) 2652018..2652785 - 768 WP_000279500.1 cellulose biosynthesis protein BcsQ -
MYF53_RS12950 (2652797) 2652797..2652985 - 189 WP_001063310.1 cellulose biosynthesis protein BcsR -
MYF53_RS12955 (2653272) 2653272..2654831 + 1560 WP_001070267.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
MYF53_RS12960 (2654828) 2654828..2655019 + 192 WP_000981122.1 cellulose biosynthesis protein BcsF -
MYF53_RS12965 (2655016) 2655016..2656695 + 1680 WP_249895900.1 cellulose biosynthesis protein BcsG -
MYF53_RS12970 (2656782) 2656782..2656889 - 108 WP_000170746.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2656947) 2656947..2657001 + 55 NuclAT_16 - Antitoxin
- (2656947) 2656947..2657001 + 55 NuclAT_16 - Antitoxin
- (2656947) 2656947..2657001 + 55 NuclAT_16 - Antitoxin
- (2656947) 2656947..2657001 + 55 NuclAT_16 - Antitoxin
- (2656947) 2656947..2657001 + 55 NuclAT_18 - Antitoxin
- (2656947) 2656947..2657001 + 55 NuclAT_18 - Antitoxin
- (2656947) 2656947..2657001 + 55 NuclAT_18 - Antitoxin
- (2656947) 2656947..2657001 + 55 NuclAT_18 - Antitoxin
- (2656947) 2656947..2657001 + 55 NuclAT_20 - Antitoxin
- (2656947) 2656947..2657001 + 55 NuclAT_20 - Antitoxin
- (2656947) 2656947..2657001 + 55 NuclAT_20 - Antitoxin
- (2656947) 2656947..2657001 + 55 NuclAT_20 - Antitoxin
- (2656947) 2656947..2657001 + 55 NuclAT_22 - Antitoxin
- (2656947) 2656947..2657001 + 55 NuclAT_22 - Antitoxin
- (2656947) 2656947..2657001 + 55 NuclAT_22 - Antitoxin
- (2656947) 2656947..2657001 + 55 NuclAT_22 - Antitoxin
- (2656947) 2656947..2657003 + 57 NuclAT_11 - -
- (2656947) 2656947..2657003 + 57 NuclAT_11 - -
- (2656947) 2656947..2657003 + 57 NuclAT_11 - -
- (2656947) 2656947..2657003 + 57 NuclAT_11 - -
- (2656947) 2656947..2657003 + 57 NuclAT_13 - -
- (2656947) 2656947..2657003 + 57 NuclAT_13 - -
- (2656947) 2656947..2657003 + 57 NuclAT_13 - -
- (2656947) 2656947..2657003 + 57 NuclAT_13 - -
MYF53_RS12975 (2657264) 2657264..2657371 - 108 WP_072132476.1 type I toxin-antitoxin system toxin Ldr family protein -
MYF53_RS12985 (2657746) 2657746..2657853 - 108 WP_000170738.1 type I toxin-antitoxin system toxin Ldr family protein -
MYF53_RS12990 (2658229) 2658229..2658336 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
- (2658385) 2658385..2658448 + 64 NuclAT_15 - -
- (2658385) 2658385..2658448 + 64 NuclAT_15 - -
- (2658385) 2658385..2658448 + 64 NuclAT_15 - -
- (2658385) 2658385..2658448 + 64 NuclAT_15 - -
- (2658385) 2658385..2658448 + 64 NuclAT_17 - -
- (2658385) 2658385..2658448 + 64 NuclAT_17 - -
- (2658385) 2658385..2658448 + 64 NuclAT_17 - -
- (2658385) 2658385..2658448 + 64 NuclAT_17 - -
- (2658385) 2658385..2658448 + 64 NuclAT_19 - -
- (2658385) 2658385..2658448 + 64 NuclAT_19 - -
- (2658385) 2658385..2658448 + 64 NuclAT_19 - -
- (2658385) 2658385..2658448 + 64 NuclAT_19 - -
- (2658385) 2658385..2658448 + 64 NuclAT_21 - -
- (2658385) 2658385..2658448 + 64 NuclAT_21 - -
- (2658385) 2658385..2658448 + 64 NuclAT_21 - -
- (2658385) 2658385..2658448 + 64 NuclAT_21 - -
- (2658385) 2658385..2658450 + 66 NuclAT_10 - -
- (2658385) 2658385..2658450 + 66 NuclAT_10 - -
- (2658385) 2658385..2658450 + 66 NuclAT_10 - -
- (2658385) 2658385..2658450 + 66 NuclAT_10 - -
- (2658385) 2658385..2658450 + 66 NuclAT_12 - -
- (2658385) 2658385..2658450 + 66 NuclAT_12 - -
- (2658385) 2658385..2658450 + 66 NuclAT_12 - -
- (2658385) 2658385..2658450 + 66 NuclAT_12 - -
MYF53_RS13000 (2658772) 2658772..2659968 + 1197 WP_001016304.1 methionine gamma-lyase -
MYF53_RS13005 (2660218) 2660218..2661516 + 1299 WP_249895901.1 amino acid permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3912.73 Da        Isoelectric Point: 9.0157

>T242606 WP_000170746.1 NZ_CP095843:c2656889-2656782 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVITGILASMIVNWLNKRK

Download         Length: 108 bp

>T242606 NZ_OW848981:c79085-78936 [Escherichia coli]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGAGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA

Antitoxin


Download         Length: 55 bp

>AT242606 NZ_CP095843:2656947-2657001 [Escherichia fergusonii]
CAAGAATGGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A826RQE3

Antitoxin

Download structure file

References