Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-agrB/Ldr(toxin) |
| Location | 2656782..2657001 | Replicon | chromosome |
| Accession | NZ_CP095843 | ||
| Organism | Escherichia fergusonii strain EF21QZZ116 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | A0A826RQE3 |
| Locus tag | MYF53_RS12970 | Protein ID | WP_000170746.1 |
| Coordinates | 2656782..2656889 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | agrB | ||
| Locus tag | - | ||
| Coordinates | 2656947..2657001 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MYF53_RS12945 (2652018) | 2652018..2652785 | - | 768 | WP_000279500.1 | cellulose biosynthesis protein BcsQ | - |
| MYF53_RS12950 (2652797) | 2652797..2652985 | - | 189 | WP_001063310.1 | cellulose biosynthesis protein BcsR | - |
| MYF53_RS12955 (2653272) | 2653272..2654831 | + | 1560 | WP_001070267.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
| MYF53_RS12960 (2654828) | 2654828..2655019 | + | 192 | WP_000981122.1 | cellulose biosynthesis protein BcsF | - |
| MYF53_RS12965 (2655016) | 2655016..2656695 | + | 1680 | WP_249895900.1 | cellulose biosynthesis protein BcsG | - |
| MYF53_RS12970 (2656782) | 2656782..2656889 | - | 108 | WP_000170746.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (2656947) | 2656947..2657001 | + | 55 | NuclAT_16 | - | Antitoxin |
| - (2656947) | 2656947..2657001 | + | 55 | NuclAT_16 | - | Antitoxin |
| - (2656947) | 2656947..2657001 | + | 55 | NuclAT_16 | - | Antitoxin |
| - (2656947) | 2656947..2657001 | + | 55 | NuclAT_16 | - | Antitoxin |
| - (2656947) | 2656947..2657001 | + | 55 | NuclAT_18 | - | Antitoxin |
| - (2656947) | 2656947..2657001 | + | 55 | NuclAT_18 | - | Antitoxin |
| - (2656947) | 2656947..2657001 | + | 55 | NuclAT_18 | - | Antitoxin |
| - (2656947) | 2656947..2657001 | + | 55 | NuclAT_18 | - | Antitoxin |
| - (2656947) | 2656947..2657001 | + | 55 | NuclAT_20 | - | Antitoxin |
| - (2656947) | 2656947..2657001 | + | 55 | NuclAT_20 | - | Antitoxin |
| - (2656947) | 2656947..2657001 | + | 55 | NuclAT_20 | - | Antitoxin |
| - (2656947) | 2656947..2657001 | + | 55 | NuclAT_20 | - | Antitoxin |
| - (2656947) | 2656947..2657001 | + | 55 | NuclAT_22 | - | Antitoxin |
| - (2656947) | 2656947..2657001 | + | 55 | NuclAT_22 | - | Antitoxin |
| - (2656947) | 2656947..2657001 | + | 55 | NuclAT_22 | - | Antitoxin |
| - (2656947) | 2656947..2657001 | + | 55 | NuclAT_22 | - | Antitoxin |
| - (2656947) | 2656947..2657003 | + | 57 | NuclAT_11 | - | - |
| - (2656947) | 2656947..2657003 | + | 57 | NuclAT_11 | - | - |
| - (2656947) | 2656947..2657003 | + | 57 | NuclAT_11 | - | - |
| - (2656947) | 2656947..2657003 | + | 57 | NuclAT_11 | - | - |
| - (2656947) | 2656947..2657003 | + | 57 | NuclAT_13 | - | - |
| - (2656947) | 2656947..2657003 | + | 57 | NuclAT_13 | - | - |
| - (2656947) | 2656947..2657003 | + | 57 | NuclAT_13 | - | - |
| - (2656947) | 2656947..2657003 | + | 57 | NuclAT_13 | - | - |
| MYF53_RS12975 (2657264) | 2657264..2657371 | - | 108 | WP_072132476.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| MYF53_RS12985 (2657746) | 2657746..2657853 | - | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| MYF53_RS12990 (2658229) | 2658229..2658336 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (2658385) | 2658385..2658448 | + | 64 | NuclAT_15 | - | - |
| - (2658385) | 2658385..2658448 | + | 64 | NuclAT_15 | - | - |
| - (2658385) | 2658385..2658448 | + | 64 | NuclAT_15 | - | - |
| - (2658385) | 2658385..2658448 | + | 64 | NuclAT_15 | - | - |
| - (2658385) | 2658385..2658448 | + | 64 | NuclAT_17 | - | - |
| - (2658385) | 2658385..2658448 | + | 64 | NuclAT_17 | - | - |
| - (2658385) | 2658385..2658448 | + | 64 | NuclAT_17 | - | - |
| - (2658385) | 2658385..2658448 | + | 64 | NuclAT_17 | - | - |
| - (2658385) | 2658385..2658448 | + | 64 | NuclAT_19 | - | - |
| - (2658385) | 2658385..2658448 | + | 64 | NuclAT_19 | - | - |
| - (2658385) | 2658385..2658448 | + | 64 | NuclAT_19 | - | - |
| - (2658385) | 2658385..2658448 | + | 64 | NuclAT_19 | - | - |
| - (2658385) | 2658385..2658448 | + | 64 | NuclAT_21 | - | - |
| - (2658385) | 2658385..2658448 | + | 64 | NuclAT_21 | - | - |
| - (2658385) | 2658385..2658448 | + | 64 | NuclAT_21 | - | - |
| - (2658385) | 2658385..2658448 | + | 64 | NuclAT_21 | - | - |
| - (2658385) | 2658385..2658450 | + | 66 | NuclAT_10 | - | - |
| - (2658385) | 2658385..2658450 | + | 66 | NuclAT_10 | - | - |
| - (2658385) | 2658385..2658450 | + | 66 | NuclAT_10 | - | - |
| - (2658385) | 2658385..2658450 | + | 66 | NuclAT_10 | - | - |
| - (2658385) | 2658385..2658450 | + | 66 | NuclAT_12 | - | - |
| - (2658385) | 2658385..2658450 | + | 66 | NuclAT_12 | - | - |
| - (2658385) | 2658385..2658450 | + | 66 | NuclAT_12 | - | - |
| - (2658385) | 2658385..2658450 | + | 66 | NuclAT_12 | - | - |
| MYF53_RS13000 (2658772) | 2658772..2659968 | + | 1197 | WP_001016304.1 | methionine gamma-lyase | - |
| MYF53_RS13005 (2660218) | 2660218..2661516 | + | 1299 | WP_249895901.1 | amino acid permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3912.73 Da Isoelectric Point: 9.0157
>T242606 WP_000170746.1 NZ_CP095843:c2656889-2656782 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVITGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVITGILASMIVNWLNKRK
Download Length: 108 bp
>T242606 NZ_OW848981:c79085-78936 [Escherichia coli]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGAGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGAGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 55 bp
>AT242606 NZ_CP095843:2656947-2657001 [Escherichia fergusonii]
CAAGAATGGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT
CAAGAATGGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|