Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 3385304..3385562 | Replicon | chromosome |
| Accession | NZ_CP095786 | ||
| Organism | Escherichia fergusonii strain EF21JD053 | ||
Toxin (Protein)
| Gene name | hokC | Uniprot ID | S1NX00 |
| Locus tag | MYB88_RS16180 | Protein ID | WP_000809168.1 |
| Coordinates | 3385304..3385456 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokC | ||
| Locus tag | - | ||
| Coordinates | 3385505..3385562 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MYB88_RS16160 | 3380370..3380957 | + | 588 | WP_002431696.1 | molybdopterin adenylyltransferase | - |
| MYB88_RS16165 | 3380991..3381557 | - | 567 | WP_000528529.1 | acetate uptake transporter | - |
| MYB88_RS16170 | 3382065..3383981 | + | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
| MYB88_RS16175 | 3384070..3385200 | + | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
| MYB88_RS16180 | 3385304..3385456 | - | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
| - | 3385505..3385562 | + | 58 | - | - | Antitoxin |
| MYB88_RS16185 | 3385997..3387163 | + | 1167 | WP_000681374.1 | Na+/H+ antiporter NhaA | - |
| MYB88_RS16190 | 3387231..3388130 | + | 900 | WP_000019049.1 | transcriptional activator NhaR | - |
| MYB88_RS16195 | 3388226..3388489 | - | 264 | WP_001274021.1 | 30S ribosomal protein S20 | - |
| MYB88_RS16200 | 3388592..3388810 | + | 219 | WP_097343043.1 | DUF2575 family protein | - |
| MYB88_RS16205 | 3388818..3389759 | + | 942 | WP_042021512.1 | bifunctional riboflavin kinase/FAD synthetase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T242577 WP_000809168.1 NZ_CP095786:c3385456-3385304 [Escherichia fergusonii]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
>T242577 NZ_OW848788:2193879-2193982 [Citrobacter freundii]
GGCAGGGTAACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTATTCGGTCTCTTTTT
GGCAGGGTAACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: 58 bp
>AT242577 NZ_CP095786:3385505-3385562 [Escherichia fergusonii]
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|