Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2114099..2114320 Replicon chromosome
Accession NZ_CP095529
Organism Escherichia coli strain GN06156

Toxin (Protein)


Gene name ldrD Uniprot ID A0A229AEQ8
Locus tag MW397_RS10015 Protein ID WP_000176713.1
Coordinates 2114099..2114206 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2114254..2114320 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MW397_RS09990 (2109944) 2109944..2111026 + 1083 WP_000804726.1 peptide chain release factor 1 -
MW397_RS09995 (2111026) 2111026..2111859 + 834 WP_000456570.1 peptide chain release factor N(5)-glutamine methyltransferase -
MW397_RS10000 (2111856) 2111856..2112248 + 393 WP_000200371.1 invasion regulator SirB2 -
MW397_RS10005 (2112252) 2112252..2113061 + 810 WP_001257044.1 invasion regulator SirB1 -
MW397_RS10010 (2113097) 2113097..2113951 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
MW397_RS10015 (2114099) 2114099..2114206 - 108 WP_000176713.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2114256) 2114256..2114319 + 64 NuclAT_27 - -
- (2114256) 2114256..2114319 + 64 NuclAT_27 - -
- (2114256) 2114256..2114319 + 64 NuclAT_27 - -
- (2114256) 2114256..2114319 + 64 NuclAT_27 - -
- (2114256) 2114256..2114319 + 64 NuclAT_29 - -
- (2114256) 2114256..2114319 + 64 NuclAT_29 - -
- (2114256) 2114256..2114319 + 64 NuclAT_29 - -
- (2114256) 2114256..2114319 + 64 NuclAT_29 - -
- (2114256) 2114256..2114319 + 64 NuclAT_31 - -
- (2114256) 2114256..2114319 + 64 NuclAT_31 - -
- (2114256) 2114256..2114319 + 64 NuclAT_31 - -
- (2114256) 2114256..2114319 + 64 NuclAT_31 - -
- (2114256) 2114256..2114319 + 64 NuclAT_33 - -
- (2114256) 2114256..2114319 + 64 NuclAT_33 - -
- (2114256) 2114256..2114319 + 64 NuclAT_33 - -
- (2114256) 2114256..2114319 + 64 NuclAT_33 - -
- (2114256) 2114256..2114319 + 64 NuclAT_35 - -
- (2114256) 2114256..2114319 + 64 NuclAT_35 - -
- (2114256) 2114256..2114319 + 64 NuclAT_35 - -
- (2114256) 2114256..2114319 + 64 NuclAT_35 - -
- (2114256) 2114256..2114319 + 64 NuclAT_37 - -
- (2114256) 2114256..2114319 + 64 NuclAT_37 - -
- (2114256) 2114256..2114319 + 64 NuclAT_37 - -
- (2114256) 2114256..2114319 + 64 NuclAT_37 - -
- (2114254) 2114254..2114320 + 67 NuclAT_15 - Antitoxin
- (2114254) 2114254..2114320 + 67 NuclAT_15 - Antitoxin
- (2114254) 2114254..2114320 + 67 NuclAT_15 - Antitoxin
- (2114254) 2114254..2114320 + 67 NuclAT_15 - Antitoxin
- (2114254) 2114254..2114320 + 67 NuclAT_17 - Antitoxin
- (2114254) 2114254..2114320 + 67 NuclAT_17 - Antitoxin
- (2114254) 2114254..2114320 + 67 NuclAT_17 - Antitoxin
- (2114254) 2114254..2114320 + 67 NuclAT_17 - Antitoxin
- (2114254) 2114254..2114320 + 67 NuclAT_19 - Antitoxin
- (2114254) 2114254..2114320 + 67 NuclAT_19 - Antitoxin
- (2114254) 2114254..2114320 + 67 NuclAT_19 - Antitoxin
- (2114254) 2114254..2114320 + 67 NuclAT_19 - Antitoxin
- (2114254) 2114254..2114320 + 67 NuclAT_21 - Antitoxin
- (2114254) 2114254..2114320 + 67 NuclAT_21 - Antitoxin
- (2114254) 2114254..2114320 + 67 NuclAT_21 - Antitoxin
- (2114254) 2114254..2114320 + 67 NuclAT_21 - Antitoxin
- (2114254) 2114254..2114320 + 67 NuclAT_23 - Antitoxin
- (2114254) 2114254..2114320 + 67 NuclAT_23 - Antitoxin
- (2114254) 2114254..2114320 + 67 NuclAT_23 - Antitoxin
- (2114254) 2114254..2114320 + 67 NuclAT_23 - Antitoxin
- (2114254) 2114254..2114320 + 67 NuclAT_25 - Antitoxin
- (2114254) 2114254..2114320 + 67 NuclAT_25 - Antitoxin
- (2114254) 2114254..2114320 + 67 NuclAT_25 - Antitoxin
- (2114254) 2114254..2114320 + 67 NuclAT_25 - Antitoxin
- (2114256) 2114256..2114321 + 66 NuclAT_39 - -
- (2114256) 2114256..2114321 + 66 NuclAT_39 - -
- (2114256) 2114256..2114321 + 66 NuclAT_39 - -
- (2114256) 2114256..2114321 + 66 NuclAT_39 - -
- (2114256) 2114256..2114321 + 66 NuclAT_41 - -
- (2114256) 2114256..2114321 + 66 NuclAT_41 - -
- (2114256) 2114256..2114321 + 66 NuclAT_41 - -
- (2114256) 2114256..2114321 + 66 NuclAT_41 - -
MW397_RS10020 (2114634) 2114634..2114741 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (2114794) 2114794..2114855 + 62 NuclAT_28 - -
- (2114794) 2114794..2114855 + 62 NuclAT_28 - -
- (2114794) 2114794..2114855 + 62 NuclAT_28 - -
- (2114794) 2114794..2114855 + 62 NuclAT_28 - -
- (2114794) 2114794..2114855 + 62 NuclAT_30 - -
- (2114794) 2114794..2114855 + 62 NuclAT_30 - -
- (2114794) 2114794..2114855 + 62 NuclAT_30 - -
- (2114794) 2114794..2114855 + 62 NuclAT_30 - -
- (2114794) 2114794..2114855 + 62 NuclAT_32 - -
- (2114794) 2114794..2114855 + 62 NuclAT_32 - -
- (2114794) 2114794..2114855 + 62 NuclAT_32 - -
- (2114794) 2114794..2114855 + 62 NuclAT_32 - -
- (2114794) 2114794..2114855 + 62 NuclAT_34 - -
- (2114794) 2114794..2114855 + 62 NuclAT_34 - -
- (2114794) 2114794..2114855 + 62 NuclAT_34 - -
- (2114794) 2114794..2114855 + 62 NuclAT_34 - -
- (2114794) 2114794..2114855 + 62 NuclAT_36 - -
- (2114794) 2114794..2114855 + 62 NuclAT_36 - -
- (2114794) 2114794..2114855 + 62 NuclAT_36 - -
- (2114794) 2114794..2114855 + 62 NuclAT_36 - -
- (2114794) 2114794..2114855 + 62 NuclAT_38 - -
- (2114794) 2114794..2114855 + 62 NuclAT_38 - -
- (2114794) 2114794..2114855 + 62 NuclAT_38 - -
- (2114794) 2114794..2114855 + 62 NuclAT_38 - -
- (2114794) 2114794..2114856 + 63 NuclAT_16 - -
- (2114794) 2114794..2114856 + 63 NuclAT_16 - -
- (2114794) 2114794..2114856 + 63 NuclAT_16 - -
- (2114794) 2114794..2114856 + 63 NuclAT_16 - -
- (2114794) 2114794..2114856 + 63 NuclAT_18 - -
- (2114794) 2114794..2114856 + 63 NuclAT_18 - -
- (2114794) 2114794..2114856 + 63 NuclAT_18 - -
- (2114794) 2114794..2114856 + 63 NuclAT_18 - -
- (2114794) 2114794..2114856 + 63 NuclAT_20 - -
- (2114794) 2114794..2114856 + 63 NuclAT_20 - -
- (2114794) 2114794..2114856 + 63 NuclAT_20 - -
- (2114794) 2114794..2114856 + 63 NuclAT_20 - -
- (2114794) 2114794..2114856 + 63 NuclAT_22 - -
- (2114794) 2114794..2114856 + 63 NuclAT_22 - -
- (2114794) 2114794..2114856 + 63 NuclAT_22 - -
- (2114794) 2114794..2114856 + 63 NuclAT_22 - -
- (2114794) 2114794..2114856 + 63 NuclAT_24 - -
- (2114794) 2114794..2114856 + 63 NuclAT_24 - -
- (2114794) 2114794..2114856 + 63 NuclAT_24 - -
- (2114794) 2114794..2114856 + 63 NuclAT_24 - -
- (2114794) 2114794..2114856 + 63 NuclAT_26 - -
- (2114794) 2114794..2114856 + 63 NuclAT_26 - -
- (2114794) 2114794..2114856 + 63 NuclAT_26 - -
- (2114794) 2114794..2114856 + 63 NuclAT_26 - -
- (2114794) 2114794..2114857 + 64 NuclAT_40 - -
- (2114794) 2114794..2114857 + 64 NuclAT_40 - -
- (2114794) 2114794..2114857 + 64 NuclAT_40 - -
- (2114794) 2114794..2114857 + 64 NuclAT_40 - -
- (2114794) 2114794..2114857 + 64 NuclAT_42 - -
- (2114794) 2114794..2114857 + 64 NuclAT_42 - -
- (2114794) 2114794..2114857 + 64 NuclAT_42 - -
- (2114794) 2114794..2114857 + 64 NuclAT_42 - -
MW397_RS10025 (2115147) 2115147..2116247 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
MW397_RS10030 (2116517) 2116517..2116747 + 231 WP_001146444.1 putative cation transport regulator ChaB -
MW397_RS10035 (2116905) 2116905..2117600 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
MW397_RS10040 (2117644) 2117644..2117997 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4031.79 Da        Isoelectric Point: 11.4779

>T242294 WP_000176713.1 NZ_CP095529:c2114206-2114099 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T242294 NZ_OW052302:3614539-3614931 [Mycobacterium tuberculosis]
ATGACGACGGTGCTGCTCGACTCGCATGTGGCCTACTGGTGGTCGGCCGAGCCGCAGCGTCTCAGCATGGCGGCGAGCCA
GGCCATCGAACACGCCGACGAGCTCGCCGTCGCCGCGATTTCGTGGTTCGAGCTGGCTTGGCTTGCCGAACAGGAACGCA
TCCAACTGGCGATTCCGGTGCTGTCCTGGCTTCAGCAGCTGGCCGAGCACGTTCGCACCGTCGGTATCACGCCCTCGGTC
GCCGCCACGGCGGTGGCGCTGCCCTCGTCGTTCCCCGGCGATCCGGCCGACCGGTTGATCTACGCCACCGCGATCGAACA
CGGCTGGCGGCTGGTGACCAAGGACCGGCGGCTACGCAGTCATCGGCACCCACGACCGGTCACCGTCTGGTAG

Antitoxin


Download         Length: 67 bp

>AT242294 NZ_CP095529:2114254-2114320 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A229AEQ8

Antitoxin

Download structure file

References