Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 2114099..2114320 | Replicon | chromosome |
| Accession | NZ_CP095529 | ||
| Organism | Escherichia coli strain GN06156 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | A0A229AEQ8 |
| Locus tag | MW397_RS10015 | Protein ID | WP_000176713.1 |
| Coordinates | 2114099..2114206 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 2114254..2114320 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MW397_RS09990 (2109944) | 2109944..2111026 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| MW397_RS09995 (2111026) | 2111026..2111859 | + | 834 | WP_000456570.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| MW397_RS10000 (2111856) | 2111856..2112248 | + | 393 | WP_000200371.1 | invasion regulator SirB2 | - |
| MW397_RS10005 (2112252) | 2112252..2113061 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| MW397_RS10010 (2113097) | 2113097..2113951 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| MW397_RS10015 (2114099) | 2114099..2114206 | - | 108 | WP_000176713.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (2114256) | 2114256..2114319 | + | 64 | NuclAT_27 | - | - |
| - (2114256) | 2114256..2114319 | + | 64 | NuclAT_27 | - | - |
| - (2114256) | 2114256..2114319 | + | 64 | NuclAT_27 | - | - |
| - (2114256) | 2114256..2114319 | + | 64 | NuclAT_27 | - | - |
| - (2114256) | 2114256..2114319 | + | 64 | NuclAT_29 | - | - |
| - (2114256) | 2114256..2114319 | + | 64 | NuclAT_29 | - | - |
| - (2114256) | 2114256..2114319 | + | 64 | NuclAT_29 | - | - |
| - (2114256) | 2114256..2114319 | + | 64 | NuclAT_29 | - | - |
| - (2114256) | 2114256..2114319 | + | 64 | NuclAT_31 | - | - |
| - (2114256) | 2114256..2114319 | + | 64 | NuclAT_31 | - | - |
| - (2114256) | 2114256..2114319 | + | 64 | NuclAT_31 | - | - |
| - (2114256) | 2114256..2114319 | + | 64 | NuclAT_31 | - | - |
| - (2114256) | 2114256..2114319 | + | 64 | NuclAT_33 | - | - |
| - (2114256) | 2114256..2114319 | + | 64 | NuclAT_33 | - | - |
| - (2114256) | 2114256..2114319 | + | 64 | NuclAT_33 | - | - |
| - (2114256) | 2114256..2114319 | + | 64 | NuclAT_33 | - | - |
| - (2114256) | 2114256..2114319 | + | 64 | NuclAT_35 | - | - |
| - (2114256) | 2114256..2114319 | + | 64 | NuclAT_35 | - | - |
| - (2114256) | 2114256..2114319 | + | 64 | NuclAT_35 | - | - |
| - (2114256) | 2114256..2114319 | + | 64 | NuclAT_35 | - | - |
| - (2114256) | 2114256..2114319 | + | 64 | NuclAT_37 | - | - |
| - (2114256) | 2114256..2114319 | + | 64 | NuclAT_37 | - | - |
| - (2114256) | 2114256..2114319 | + | 64 | NuclAT_37 | - | - |
| - (2114256) | 2114256..2114319 | + | 64 | NuclAT_37 | - | - |
| - (2114254) | 2114254..2114320 | + | 67 | NuclAT_15 | - | Antitoxin |
| - (2114254) | 2114254..2114320 | + | 67 | NuclAT_15 | - | Antitoxin |
| - (2114254) | 2114254..2114320 | + | 67 | NuclAT_15 | - | Antitoxin |
| - (2114254) | 2114254..2114320 | + | 67 | NuclAT_15 | - | Antitoxin |
| - (2114254) | 2114254..2114320 | + | 67 | NuclAT_17 | - | Antitoxin |
| - (2114254) | 2114254..2114320 | + | 67 | NuclAT_17 | - | Antitoxin |
| - (2114254) | 2114254..2114320 | + | 67 | NuclAT_17 | - | Antitoxin |
| - (2114254) | 2114254..2114320 | + | 67 | NuclAT_17 | - | Antitoxin |
| - (2114254) | 2114254..2114320 | + | 67 | NuclAT_19 | - | Antitoxin |
| - (2114254) | 2114254..2114320 | + | 67 | NuclAT_19 | - | Antitoxin |
| - (2114254) | 2114254..2114320 | + | 67 | NuclAT_19 | - | Antitoxin |
| - (2114254) | 2114254..2114320 | + | 67 | NuclAT_19 | - | Antitoxin |
| - (2114254) | 2114254..2114320 | + | 67 | NuclAT_21 | - | Antitoxin |
| - (2114254) | 2114254..2114320 | + | 67 | NuclAT_21 | - | Antitoxin |
| - (2114254) | 2114254..2114320 | + | 67 | NuclAT_21 | - | Antitoxin |
| - (2114254) | 2114254..2114320 | + | 67 | NuclAT_21 | - | Antitoxin |
| - (2114254) | 2114254..2114320 | + | 67 | NuclAT_23 | - | Antitoxin |
| - (2114254) | 2114254..2114320 | + | 67 | NuclAT_23 | - | Antitoxin |
| - (2114254) | 2114254..2114320 | + | 67 | NuclAT_23 | - | Antitoxin |
| - (2114254) | 2114254..2114320 | + | 67 | NuclAT_23 | - | Antitoxin |
| - (2114254) | 2114254..2114320 | + | 67 | NuclAT_25 | - | Antitoxin |
| - (2114254) | 2114254..2114320 | + | 67 | NuclAT_25 | - | Antitoxin |
| - (2114254) | 2114254..2114320 | + | 67 | NuclAT_25 | - | Antitoxin |
| - (2114254) | 2114254..2114320 | + | 67 | NuclAT_25 | - | Antitoxin |
| - (2114256) | 2114256..2114321 | + | 66 | NuclAT_39 | - | - |
| - (2114256) | 2114256..2114321 | + | 66 | NuclAT_39 | - | - |
| - (2114256) | 2114256..2114321 | + | 66 | NuclAT_39 | - | - |
| - (2114256) | 2114256..2114321 | + | 66 | NuclAT_39 | - | - |
| - (2114256) | 2114256..2114321 | + | 66 | NuclAT_41 | - | - |
| - (2114256) | 2114256..2114321 | + | 66 | NuclAT_41 | - | - |
| - (2114256) | 2114256..2114321 | + | 66 | NuclAT_41 | - | - |
| - (2114256) | 2114256..2114321 | + | 66 | NuclAT_41 | - | - |
| MW397_RS10020 (2114634) | 2114634..2114741 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (2114794) | 2114794..2114855 | + | 62 | NuclAT_28 | - | - |
| - (2114794) | 2114794..2114855 | + | 62 | NuclAT_28 | - | - |
| - (2114794) | 2114794..2114855 | + | 62 | NuclAT_28 | - | - |
| - (2114794) | 2114794..2114855 | + | 62 | NuclAT_28 | - | - |
| - (2114794) | 2114794..2114855 | + | 62 | NuclAT_30 | - | - |
| - (2114794) | 2114794..2114855 | + | 62 | NuclAT_30 | - | - |
| - (2114794) | 2114794..2114855 | + | 62 | NuclAT_30 | - | - |
| - (2114794) | 2114794..2114855 | + | 62 | NuclAT_30 | - | - |
| - (2114794) | 2114794..2114855 | + | 62 | NuclAT_32 | - | - |
| - (2114794) | 2114794..2114855 | + | 62 | NuclAT_32 | - | - |
| - (2114794) | 2114794..2114855 | + | 62 | NuclAT_32 | - | - |
| - (2114794) | 2114794..2114855 | + | 62 | NuclAT_32 | - | - |
| - (2114794) | 2114794..2114855 | + | 62 | NuclAT_34 | - | - |
| - (2114794) | 2114794..2114855 | + | 62 | NuclAT_34 | - | - |
| - (2114794) | 2114794..2114855 | + | 62 | NuclAT_34 | - | - |
| - (2114794) | 2114794..2114855 | + | 62 | NuclAT_34 | - | - |
| - (2114794) | 2114794..2114855 | + | 62 | NuclAT_36 | - | - |
| - (2114794) | 2114794..2114855 | + | 62 | NuclAT_36 | - | - |
| - (2114794) | 2114794..2114855 | + | 62 | NuclAT_36 | - | - |
| - (2114794) | 2114794..2114855 | + | 62 | NuclAT_36 | - | - |
| - (2114794) | 2114794..2114855 | + | 62 | NuclAT_38 | - | - |
| - (2114794) | 2114794..2114855 | + | 62 | NuclAT_38 | - | - |
| - (2114794) | 2114794..2114855 | + | 62 | NuclAT_38 | - | - |
| - (2114794) | 2114794..2114855 | + | 62 | NuclAT_38 | - | - |
| - (2114794) | 2114794..2114856 | + | 63 | NuclAT_16 | - | - |
| - (2114794) | 2114794..2114856 | + | 63 | NuclAT_16 | - | - |
| - (2114794) | 2114794..2114856 | + | 63 | NuclAT_16 | - | - |
| - (2114794) | 2114794..2114856 | + | 63 | NuclAT_16 | - | - |
| - (2114794) | 2114794..2114856 | + | 63 | NuclAT_18 | - | - |
| - (2114794) | 2114794..2114856 | + | 63 | NuclAT_18 | - | - |
| - (2114794) | 2114794..2114856 | + | 63 | NuclAT_18 | - | - |
| - (2114794) | 2114794..2114856 | + | 63 | NuclAT_18 | - | - |
| - (2114794) | 2114794..2114856 | + | 63 | NuclAT_20 | - | - |
| - (2114794) | 2114794..2114856 | + | 63 | NuclAT_20 | - | - |
| - (2114794) | 2114794..2114856 | + | 63 | NuclAT_20 | - | - |
| - (2114794) | 2114794..2114856 | + | 63 | NuclAT_20 | - | - |
| - (2114794) | 2114794..2114856 | + | 63 | NuclAT_22 | - | - |
| - (2114794) | 2114794..2114856 | + | 63 | NuclAT_22 | - | - |
| - (2114794) | 2114794..2114856 | + | 63 | NuclAT_22 | - | - |
| - (2114794) | 2114794..2114856 | + | 63 | NuclAT_22 | - | - |
| - (2114794) | 2114794..2114856 | + | 63 | NuclAT_24 | - | - |
| - (2114794) | 2114794..2114856 | + | 63 | NuclAT_24 | - | - |
| - (2114794) | 2114794..2114856 | + | 63 | NuclAT_24 | - | - |
| - (2114794) | 2114794..2114856 | + | 63 | NuclAT_24 | - | - |
| - (2114794) | 2114794..2114856 | + | 63 | NuclAT_26 | - | - |
| - (2114794) | 2114794..2114856 | + | 63 | NuclAT_26 | - | - |
| - (2114794) | 2114794..2114856 | + | 63 | NuclAT_26 | - | - |
| - (2114794) | 2114794..2114856 | + | 63 | NuclAT_26 | - | - |
| - (2114794) | 2114794..2114857 | + | 64 | NuclAT_40 | - | - |
| - (2114794) | 2114794..2114857 | + | 64 | NuclAT_40 | - | - |
| - (2114794) | 2114794..2114857 | + | 64 | NuclAT_40 | - | - |
| - (2114794) | 2114794..2114857 | + | 64 | NuclAT_40 | - | - |
| - (2114794) | 2114794..2114857 | + | 64 | NuclAT_42 | - | - |
| - (2114794) | 2114794..2114857 | + | 64 | NuclAT_42 | - | - |
| - (2114794) | 2114794..2114857 | + | 64 | NuclAT_42 | - | - |
| - (2114794) | 2114794..2114857 | + | 64 | NuclAT_42 | - | - |
| MW397_RS10025 (2115147) | 2115147..2116247 | - | 1101 | WP_000063608.1 | sodium-potassium/proton antiporter ChaA | - |
| MW397_RS10030 (2116517) | 2116517..2116747 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| MW397_RS10035 (2116905) | 2116905..2117600 | + | 696 | WP_001295621.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| MW397_RS10040 (2117644) | 2117644..2117997 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4031.79 Da Isoelectric Point: 11.4779
>T242294 WP_000176713.1 NZ_CP095529:c2114206-2114099 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T242294 NZ_OW052302:3614539-3614931 [Mycobacterium tuberculosis]
ATGACGACGGTGCTGCTCGACTCGCATGTGGCCTACTGGTGGTCGGCCGAGCCGCAGCGTCTCAGCATGGCGGCGAGCCA
GGCCATCGAACACGCCGACGAGCTCGCCGTCGCCGCGATTTCGTGGTTCGAGCTGGCTTGGCTTGCCGAACAGGAACGCA
TCCAACTGGCGATTCCGGTGCTGTCCTGGCTTCAGCAGCTGGCCGAGCACGTTCGCACCGTCGGTATCACGCCCTCGGTC
GCCGCCACGGCGGTGGCGCTGCCCTCGTCGTTCCCCGGCGATCCGGCCGACCGGTTGATCTACGCCACCGCGATCGAACA
CGGCTGGCGGCTGGTGACCAAGGACCGGCGGCTACGCAGTCATCGGCACCCACGACCGGTCACCGTCTGGTAG
ATGACGACGGTGCTGCTCGACTCGCATGTGGCCTACTGGTGGTCGGCCGAGCCGCAGCGTCTCAGCATGGCGGCGAGCCA
GGCCATCGAACACGCCGACGAGCTCGCCGTCGCCGCGATTTCGTGGTTCGAGCTGGCTTGGCTTGCCGAACAGGAACGCA
TCCAACTGGCGATTCCGGTGCTGTCCTGGCTTCAGCAGCTGGCCGAGCACGTTCGCACCGTCGGTATCACGCCCTCGGTC
GCCGCCACGGCGGTGGCGCTGCCCTCGTCGTTCCCCGGCGATCCGGCCGACCGGTTGATCTACGCCACCGCGATCGAACA
CGGCTGGCGGCTGGTGACCAAGGACCGGCGGCTACGCAGTCATCGGCACCCACGACCGGTCACCGTCTGGTAG
Antitoxin
Download Length: 67 bp
>AT242294 NZ_CP095529:2114254-2114320 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|