Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1778422..1778643 Replicon chromosome
Accession NZ_CP095520
Organism Escherichia coli strain GN04171

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag MW404_RS08780 Protein ID WP_001531632.1
Coordinates 1778422..1778529 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1778577..1778643 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MW404_RS08755 (1774266) 1774266..1775348 + 1083 WP_000804726.1 peptide chain release factor 1 -
MW404_RS08760 (1775348) 1775348..1776181 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
MW404_RS08765 (1776178) 1776178..1776570 + 393 WP_000200375.1 invasion regulator SirB2 -
MW404_RS08770 (1776574) 1776574..1777383 + 810 WP_001257044.1 invasion regulator SirB1 -
MW404_RS08775 (1777419) 1777419..1778273 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
MW404_RS08780 (1778422) 1778422..1778529 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1778579) 1778579..1778642 + 64 NuclAT_12 - -
- (1778579) 1778579..1778642 + 64 NuclAT_12 - -
- (1778579) 1778579..1778642 + 64 NuclAT_12 - -
- (1778579) 1778579..1778642 + 64 NuclAT_12 - -
- (1778579) 1778579..1778642 + 64 NuclAT_13 - -
- (1778579) 1778579..1778642 + 64 NuclAT_13 - -
- (1778579) 1778579..1778642 + 64 NuclAT_13 - -
- (1778579) 1778579..1778642 + 64 NuclAT_13 - -
- (1778579) 1778579..1778642 + 64 NuclAT_14 - -
- (1778579) 1778579..1778642 + 64 NuclAT_14 - -
- (1778579) 1778579..1778642 + 64 NuclAT_14 - -
- (1778579) 1778579..1778642 + 64 NuclAT_14 - -
- (1778579) 1778579..1778642 + 64 NuclAT_15 - -
- (1778579) 1778579..1778642 + 64 NuclAT_15 - -
- (1778579) 1778579..1778642 + 64 NuclAT_15 - -
- (1778579) 1778579..1778642 + 64 NuclAT_15 - -
- (1778579) 1778579..1778642 + 64 NuclAT_16 - -
- (1778579) 1778579..1778642 + 64 NuclAT_16 - -
- (1778579) 1778579..1778642 + 64 NuclAT_16 - -
- (1778579) 1778579..1778642 + 64 NuclAT_16 - -
- (1778579) 1778579..1778642 + 64 NuclAT_17 - -
- (1778579) 1778579..1778642 + 64 NuclAT_17 - -
- (1778579) 1778579..1778642 + 64 NuclAT_17 - -
- (1778579) 1778579..1778642 + 64 NuclAT_17 - -
- (1778577) 1778577..1778643 + 67 NuclAT_10 - Antitoxin
- (1778577) 1778577..1778643 + 67 NuclAT_10 - Antitoxin
- (1778577) 1778577..1778643 + 67 NuclAT_10 - Antitoxin
- (1778577) 1778577..1778643 + 67 NuclAT_10 - Antitoxin
- (1778577) 1778577..1778643 + 67 NuclAT_5 - Antitoxin
- (1778577) 1778577..1778643 + 67 NuclAT_5 - Antitoxin
- (1778577) 1778577..1778643 + 67 NuclAT_5 - Antitoxin
- (1778577) 1778577..1778643 + 67 NuclAT_5 - Antitoxin
- (1778577) 1778577..1778643 + 67 NuclAT_6 - Antitoxin
- (1778577) 1778577..1778643 + 67 NuclAT_6 - Antitoxin
- (1778577) 1778577..1778643 + 67 NuclAT_6 - Antitoxin
- (1778577) 1778577..1778643 + 67 NuclAT_6 - Antitoxin
- (1778577) 1778577..1778643 + 67 NuclAT_7 - Antitoxin
- (1778577) 1778577..1778643 + 67 NuclAT_7 - Antitoxin
- (1778577) 1778577..1778643 + 67 NuclAT_7 - Antitoxin
- (1778577) 1778577..1778643 + 67 NuclAT_7 - Antitoxin
- (1778577) 1778577..1778643 + 67 NuclAT_8 - Antitoxin
- (1778577) 1778577..1778643 + 67 NuclAT_8 - Antitoxin
- (1778577) 1778577..1778643 + 67 NuclAT_8 - Antitoxin
- (1778577) 1778577..1778643 + 67 NuclAT_8 - Antitoxin
- (1778577) 1778577..1778643 + 67 NuclAT_9 - Antitoxin
- (1778577) 1778577..1778643 + 67 NuclAT_9 - Antitoxin
- (1778577) 1778577..1778643 + 67 NuclAT_9 - Antitoxin
- (1778577) 1778577..1778643 + 67 NuclAT_9 - Antitoxin
- (1778579) 1778579..1778644 + 66 NuclAT_18 - -
- (1778579) 1778579..1778644 + 66 NuclAT_18 - -
- (1778579) 1778579..1778644 + 66 NuclAT_18 - -
- (1778579) 1778579..1778644 + 66 NuclAT_18 - -
- (1778579) 1778579..1778644 + 66 NuclAT_19 - -
- (1778579) 1778579..1778644 + 66 NuclAT_19 - -
- (1778579) 1778579..1778644 + 66 NuclAT_19 - -
- (1778579) 1778579..1778644 + 66 NuclAT_19 - -
- (1778579) 1778579..1778644 + 66 NuclAT_20 - -
- (1778579) 1778579..1778644 + 66 NuclAT_20 - -
- (1778579) 1778579..1778644 + 66 NuclAT_20 - -
- (1778579) 1778579..1778644 + 66 NuclAT_20 - -
- (1778579) 1778579..1778644 + 66 NuclAT_21 - -
- (1778579) 1778579..1778644 + 66 NuclAT_21 - -
- (1778579) 1778579..1778644 + 66 NuclAT_21 - -
- (1778579) 1778579..1778644 + 66 NuclAT_21 - -
- (1778579) 1778579..1778644 + 66 NuclAT_22 - -
- (1778579) 1778579..1778644 + 66 NuclAT_22 - -
- (1778579) 1778579..1778644 + 66 NuclAT_22 - -
- (1778579) 1778579..1778644 + 66 NuclAT_22 - -
- (1778579) 1778579..1778644 + 66 NuclAT_23 - -
- (1778579) 1778579..1778644 + 66 NuclAT_23 - -
- (1778579) 1778579..1778644 + 66 NuclAT_23 - -
- (1778579) 1778579..1778644 + 66 NuclAT_23 - -
MW404_RS08785 (1778934) 1778934..1780034 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
MW404_RS08790 (1780304) 1780304..1780543 + 240 WP_000120702.1 putative cation transport regulator ChaB -
MW404_RS08795 (1780692) 1780692..1781387 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
MW404_RS08800 (1781431) 1781431..1781784 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
MW404_RS08805 (1781969) 1781969..1783363 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T242212 WP_001531632.1 NZ_CP095520:c1778529-1778422 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

>T242212 NZ_OW052189:1919138-1919539 [Mycobacterium tuberculosis]
GTGGATGAATGTGTAGTCGACGCGGCGGCCGTGGTTGACGCTCTCGCCGGCAAGGGCGCCAGCGCGATCGTTCTGCGCGG
TTTGCTCAAGGAGTCGATTTCTAACGCGCCGCATTTGCTGGACGCAGAGGTCGGACATGCACTCCGCCGCGCCGTGCTCA
GCGACGAAATCTCCGAAGAGCAGGCTCGCGCCGCGTTGGATGCCTTGCCTTATCTCATCGACAATCGTTACCCGCACAGC
CCACGACTGATCGAATACACATGGCAGCTAAGGCACAACGTCACGTTCTACGACGCCCTTTACGTCGCACTGGCCACCGC
ACTGGATGTCCCGCTGCTCACGGGCGACTCGCGGCTTGCGGCCGCGCCGGGCCTTCCGTGCGAAATCAAACTCGTTCGGT
GA

Antitoxin


Download         Length: 67 bp

>AT242212 NZ_CP095520:1778577-1778643 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References