Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 1953099..1953321 | Replicon | chromosome |
| Accession | NZ_CP095518 | ||
| Organism | Escherichia coli strain GN02350 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | A0A0D6GD35 |
| Locus tag | MW405_RS09125 | Protein ID | WP_000170745.1 |
| Coordinates | 1953099..1953206 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 1953263..1953321 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MW405_RS09100 | 1948352..1949104 | - | 753 | WP_000279525.1 | cellulose biosynthesis protein BcsQ | - |
| MW405_RS09105 | 1949116..1949304 | - | 189 | WP_001063314.1 | cellulose biosynthesis protein BcsR | - |
| MW405_RS09110 | 1949577..1951148 | + | 1572 | WP_001204945.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
| MW405_RS09115 | 1951145..1951336 | + | 192 | WP_000988311.1 | cellulose biosynthesis protein BcsF | - |
| MW405_RS09120 | 1951333..1953012 | + | 1680 | WP_000191567.1 | cellulose biosynthesis protein BcsG | - |
| MW405_RS09125 | 1953099..1953206 | - | 108 | WP_000170745.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 1953263..1953321 | + | 59 | - | - | Antitoxin |
| MW405_RS09130 | 1953682..1954953 | + | 1272 | WP_001467807.1 | amino acid permease | - |
| MW405_RS09135 | 1954983..1955987 | - | 1005 | WP_000103583.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| MW405_RS09140 | 1955984..1956967 | - | 984 | WP_001196477.1 | dipeptide ABC transporter ATP-binding protein | - |
| MW405_RS09145 | 1956978..1957880 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3855.68 Da Isoelectric Point: 9.0157
>T242180 WP_000170745.1 NZ_CP095518:c1953206-1953099 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVSWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVSWLNKRK
Download Length: 108 bp
>T242180 NZ_CP095518:c1953206-1953099 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAGCTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAGCTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 59 bp
>AT242180 NZ_CP095518:1953263-1953321 [Escherichia coli]
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|