Detailed information of TA system TA242012

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 2221873..2222094
• Replicon: chromosome
• Accession: NZ_CP095448
• Organism: Escherichia coli strain LS45

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: A0A229AEQ8
• Locus tag: MWN28_RS10615
• Protein ID: WP_000176713.1
• Coordinates: 2221873..2221980 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	2222028..2222094 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
MWN28_RS10590 (2217717)	2217717..2218799	+	1083	WP_000804726.1	peptide chain release factor 1	-
MWN28_RS10595 (2218799)	2218799..2219632	+	834	WP_000456446.1	peptide chain release factor N(5)-glutamine methyltransferase	-
MWN28_RS10600 (2219629)	2219629..2220021	+	393	WP_000200374.1	invasion regulator SirB2	-
MWN28_RS10605 (2220025)	2220025..2220834	+	810	WP_001257044.1	invasion regulator SirB1	-
MWN28_RS10610 (2220870)	2220870..2221724	+	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
MWN28_RS10615 (2221873)	2221873..2221980	-	108	WP_000176713.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
- (2222030)	2222030..2222093	+	64	NuclAT_45	-	-
- (2222030)	2222030..2222093	+	64	NuclAT_45	-	-
- (2222030)	2222030..2222093	+	64	NuclAT_45	-	-
- (2222030)	2222030..2222093	+	64	NuclAT_45	-	-
- (2222028)	2222028..2222094	+	67	NuclAT_13	-	Antitoxin
- (2222028)	2222028..2222094	+	67	NuclAT_13	-	Antitoxin
- (2222028)	2222028..2222094	+	67	NuclAT_13	-	Antitoxin
- (2222028)	2222028..2222094	+	67	NuclAT_13	-	Antitoxin
- (2222028)	2222028..2222094	+	67	NuclAT_15	-	Antitoxin
- (2222028)	2222028..2222094	+	67	NuclAT_15	-	Antitoxin
- (2222028)	2222028..2222094	+	67	NuclAT_15	-	Antitoxin
- (2222028)	2222028..2222094	+	67	NuclAT_15	-	Antitoxin
- (2222028)	2222028..2222094	+	67	NuclAT_17	-	Antitoxin
- (2222028)	2222028..2222094	+	67	NuclAT_17	-	Antitoxin
- (2222028)	2222028..2222094	+	67	NuclAT_17	-	Antitoxin
- (2222028)	2222028..2222094	+	67	NuclAT_17	-	Antitoxin
- (2222028)	2222028..2222094	+	67	NuclAT_19	-	Antitoxin
- (2222028)	2222028..2222094	+	67	NuclAT_19	-	Antitoxin
- (2222028)	2222028..2222094	+	67	NuclAT_19	-	Antitoxin
- (2222028)	2222028..2222094	+	67	NuclAT_19	-	Antitoxin
- (2222028)	2222028..2222094	+	67	NuclAT_21	-	Antitoxin
- (2222028)	2222028..2222094	+	67	NuclAT_21	-	Antitoxin
- (2222028)	2222028..2222094	+	67	NuclAT_21	-	Antitoxin
- (2222028)	2222028..2222094	+	67	NuclAT_21	-	Antitoxin
- (2222028)	2222028..2222094	+	67	NuclAT_23	-	Antitoxin
- (2222028)	2222028..2222094	+	67	NuclAT_23	-	Antitoxin
- (2222028)	2222028..2222094	+	67	NuclAT_23	-	Antitoxin
- (2222028)	2222028..2222094	+	67	NuclAT_23	-	Antitoxin
MWN28_RS10620 (2222408)	2222408..2222515	-	108	WP_000170956.1	type I toxin-antitoxin system toxin Ldr family protein	-
- (2222568)	2222568..2222629	+	62	NuclAT_44	-	-
- (2222568)	2222568..2222629	+	62	NuclAT_44	-	-
- (2222568)	2222568..2222629	+	62	NuclAT_44	-	-
- (2222568)	2222568..2222629	+	62	NuclAT_44	-	-
- (2222568)	2222568..2222630	+	63	NuclAT_14	-	-
- (2222568)	2222568..2222630	+	63	NuclAT_14	-	-
- (2222568)	2222568..2222630	+	63	NuclAT_14	-	-
- (2222568)	2222568..2222630	+	63	NuclAT_14	-	-
- (2222568)	2222568..2222630	+	63	NuclAT_16	-	-
- (2222568)	2222568..2222630	+	63	NuclAT_16	-	-
- (2222568)	2222568..2222630	+	63	NuclAT_16	-	-
- (2222568)	2222568..2222630	+	63	NuclAT_16	-	-
- (2222568)	2222568..2222630	+	63	NuclAT_18	-	-
- (2222568)	2222568..2222630	+	63	NuclAT_18	-	-
- (2222568)	2222568..2222630	+	63	NuclAT_18	-	-
- (2222568)	2222568..2222630	+	63	NuclAT_18	-	-
- (2222568)	2222568..2222630	+	63	NuclAT_20	-	-
- (2222568)	2222568..2222630	+	63	NuclAT_20	-	-
- (2222568)	2222568..2222630	+	63	NuclAT_20	-	-
- (2222568)	2222568..2222630	+	63	NuclAT_20	-	-
- (2222568)	2222568..2222630	+	63	NuclAT_22	-	-
- (2222568)	2222568..2222630	+	63	NuclAT_22	-	-
- (2222568)	2222568..2222630	+	63	NuclAT_22	-	-
- (2222568)	2222568..2222630	+	63	NuclAT_22	-	-
- (2222568)	2222568..2222630	+	63	NuclAT_24	-	-
- (2222568)	2222568..2222630	+	63	NuclAT_24	-	-
- (2222568)	2222568..2222630	+	63	NuclAT_24	-	-
- (2222568)	2222568..2222630	+	63	NuclAT_24	-	-
MWN28_RS10625 (2222921)	2222921..2224021	-	1101	WP_001317783.1	sodium-potassium/proton antiporter ChaA	-
MWN28_RS10630 (2224291)	2224291..2224521	+	231	WP_001146444.1	putative cation transport regulator ChaB	-
MWN28_RS10635 (2224679)	2224679..2225374	+	696	WP_012311798.1	glutathione-specific gamma-glutamylcyclotransferase	-
MWN28_RS10640 (2225418)	2225418..2225771	-	354	WP_001169669.1	DsrE/F sulfur relay family protein YchN	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 4031.79 Da
• Isoelectric Point: 11.4779

>T242012 WP_000176713.1 NZ_CP095448:c2221980-2221873 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Nucleotide

• Length: 108 bp

>T242012 NZ_OU943337:c4142631-4142143 [Salmonella enterica subsp. enterica serovar Typhi]
ATGATCTCCGCCCCTGAACCGCTTCATGCCGGGCATATTCTTACCCCCTTCTGCTGCGGTGTGGATTCAATGGATAACTG
GCTAAAACAGCGGGCGATGAAAAATCAGGTAACTGGCGCATCCCGTACCTTTGTGTGTTGCGGCAGCGATTCTGACGTAC
TGGCGTATTATTCGCTGGCGTCCAGCGCGGTAACGACAAACACCGCCCCCGGTCGCTTTCGTCGCAATATGCCCGATCCG
ATCCCGGTTGTGGTGCTGGGCCGTCTGGCGGTGGATCGGTCGCTACATGGGCAGGGCGTAGGTCGGGCGCTGGTGAGGGA
TGCCGGGCTGCGGGTGATTCAGGTGGCGGAAACTATCGGTATTCGCGGGATGCTGGTCCATGCCCTGTCGGATGAAGCGC
GGGAGTTTTACCTGCGGGTGGGGTTTGAGCCGTCGCCGATGGATCCGATGATGTTGATGGTGACGTTGGGGGATTTGGTT
CATGCCTGA

Antitoxin

Nucleotide

• Length: 67 bp

>AT242012 NZ_CP095448:2222028-2222094 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Structures

Toxin

• AlphaFold DB: A0A229AEQ8

Antitoxin