Detailed information of TA system TA241863

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 60095..60364
• Replicon: plasmid pEC9682-1
• Accession: NZ_CP095272
• Organism: Escherichia coli strain EC9682

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: MU524_RS25590
• Protein ID: WP_001372321.1
• Coordinates: 60239..60364 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	60095..60160 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
MU524_RS25535	55314..56285	+	972	WP_000817028.1	ParB/RepB/Spo0J family plasmid partition protein	-
MU524_RS25540	56922..57091	+	170	Protein_48	hypothetical protein	-
MU524_RS25545	57274..57354	-	81	Protein_49	hypothetical protein	-
MU524_RS25550	57424..57630	+	207	WP_000275856.1	hypothetical protein	-
MU524_RS25555	57656..58195	+	540	WP_000290840.1	single-stranded DNA-binding protein	-
MU524_RS25560	58263..58496	+	234	Protein_52	DUF905 family protein	-
MU524_RS25565	58524..58721	+	198	Protein_53	hypothetical protein	-
MU524_RS25570	58776..59210	+	435	WP_000845936.1	conjugation system SOS inhibitor PsiB	-
MU524_RS25575	59207..59969	+	763	Protein_55	plasmid SOS inhibition protein A	-
MU524_RS25580	59938..60126	-	189	WP_001299721.1	hypothetical protein	-
-	59938..60162	+	225	NuclAT_0	-	-
-	59938..60162	+	225	NuclAT_0	-	-
-	59938..60162	+	225	NuclAT_0	-	-
-	59938..60162	+	225	NuclAT_0	-	-
-	60095..60160	-	66	-	-	Antitoxin
MU524_RS25585	60148..60297	+	150	Protein_57	plasmid maintenance protein Mok	-
MU524_RS25590	60239..60364	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
MU524_RS25595	60584..60814	+	231	WP_071586998.1	hypothetical protein	-
MU524_RS25600	60812..60984	-	173	Protein_60	hypothetical protein	-
MU524_RS25605	61054..61260	+	207	WP_000547968.1	hypothetical protein	-
MU524_RS25610	61285..61572	+	288	WP_000107535.1	hypothetical protein	-
MU524_RS25615	61690..62511	+	822	WP_001234426.1	DUF932 domain-containing protein	-
MU524_RS25620	62808..63398	-	591	WP_001376243.1	transglycosylase SLT domain-containing protein	-
MU524_RS25625	63731..64114	+	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
MU524_RS25630	64301..64990	+	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	sitABCD / aph(3'')-Ib / sul2 / tet(B) / catA1 / dfrA17	iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA	1..146265	146265

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T241863 WP_001372321.1 NZ_CP095272:60239-60364 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

>T241863 NZ_OU659115:c66254-65976 [Providencia alcalifaciens]
ATGGAATTAAAATGGACGAGTAAGGCATTATCGGATCTTTCTCGTGTATATGATTTTTTAGCGTTATCAAACTCAGTCGC
TGCCGCGCGTGTTGTGCAAACATTGACGAAAGCCCCCATGTTGTTGTTGATAAAAAACCCCCGAATGGGAGAGCAATTGT
TTCAATTTATGCCACACGAAGTCCGTCGGATTGTGGTGGTGAATTATGAGATACGTTATGAACTCATTGATTCGACAATC
TATATTTTACGGATATGGCATACACGAGAAGATCGGTAA

Antitoxin

Nucleotide

• Length: 66 bp

>AT241863 NZ_CP095272:c60160-60095 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin