Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 78899..79168 | Replicon | plasmid p21072329_1 |
| Accession | NZ_CP095235 | ||
| Organism | Klebsiella pneumoniae strain 21072329 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | MU289_RS27410 | Protein ID | WP_001372321.1 |
| Coordinates | 79043..79168 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 78899..78964 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MU289_RS27380 | 74609..75136 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| MU289_RS27385 | 75194..75427 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| MU289_RS27390 | 75488..77511 | + | 2024 | Protein_103 | ParB/RepB/Spo0J family partition protein | - |
| MU289_RS27395 | 77580..78014 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| MU289_RS27400 | 78011..78730 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - | 78742..78966 | + | 225 | NuclAT_0 | - | - |
| - | 78742..78966 | + | 225 | NuclAT_0 | - | - |
| - | 78742..78966 | + | 225 | NuclAT_0 | - | - |
| - | 78742..78966 | + | 225 | NuclAT_0 | - | - |
| - | 78899..78964 | - | 66 | - | - | Antitoxin |
| MU289_RS27405 | 78952..79101 | + | 150 | Protein_106 | plasmid maintenance protein Mok | - |
| MU289_RS27410 | 79043..79168 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| MU289_RS27415 | 79487..79783 | - | 297 | Protein_108 | hypothetical protein | - |
| MU289_RS27420 | 80083..80379 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| MU289_RS27425 | 80490..81311 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
| MU289_RS27430 | 81608..82255 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
| MU289_RS27435 | 82532..82915 | + | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| MU289_RS27440 | 83106..83792 | + | 687 | WP_015059009.1 | PAS domain-containing protein | - |
| MU289_RS27445 | 83886..84113 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | catA2 / tet(A) / dfrA1 / qacE / sul1 / mph(A) / aph(3')-Ia / blaCTX-M-65 / fosA3 / blaTEM-1B / rmtB / blaKPC-2 | - | 1..173108 | 173108 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T241719 WP_001372321.1 NZ_CP095235:79043-79168 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
>T241719 NZ_OD940440:2717638-2717781 [Enterococcus faecalis]
ATGAATGTAAGTACTAAAATCTATGAAAGGAGAGGCCTTTTGTCAGCATATGAAACAATTCAGACAATTCTTGGGTTTGG
TATGTTTACCATTGCTTTGATTGCGCTGATTGTGAAATTGCTTAAAAATGACAAGAAAAAATAA
ATGAATGTAAGTACTAAAATCTATGAAAGGAGAGGCCTTTTGTCAGCATATGAAACAATTCAGACAATTCTTGGGTTTGG
TATGTTTACCATTGCTTTGATTGCGCTGATTGTGAAATTGCTTAAAAATGACAAGAAAAAATAA
Antitoxin
Download Length: 66 bp
>AT241719 NZ_CP095235:c78964-78899 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|