Detailed information of TA system TA241719

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 78899..79168
• Replicon: plasmid p21072329_1
• Accession: NZ_CP095235
• Organism: Klebsiella pneumoniae strain 21072329

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: MU289_RS27410
• Protein ID: WP_001372321.1
• Coordinates: 79043..79168 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	78899..78964 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
MU289_RS27380	74609..75136	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
MU289_RS27385	75194..75427	+	234	WP_000006003.1	DUF905 family protein	-
MU289_RS27390	75488..77511	+	2024	Protein_103	ParB/RepB/Spo0J family partition protein	-
MU289_RS27395	77580..78014	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
MU289_RS27400	78011..78730	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
-	78742..78966	+	225	NuclAT_0	-	-
-	78742..78966	+	225	NuclAT_0	-	-
-	78742..78966	+	225	NuclAT_0	-	-
-	78742..78966	+	225	NuclAT_0	-	-
-	78899..78964	-	66	-	-	Antitoxin
MU289_RS27405	78952..79101	+	150	Protein_106	plasmid maintenance protein Mok	-
MU289_RS27410	79043..79168	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
MU289_RS27415	79487..79783	-	297	Protein_108	hypothetical protein	-
MU289_RS27420	80083..80379	+	297	WP_001272251.1	hypothetical protein	-
MU289_RS27425	80490..81311	+	822	WP_001234445.1	DUF932 domain-containing protein	-
MU289_RS27430	81608..82255	-	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
MU289_RS27435	82532..82915	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
MU289_RS27440	83106..83792	+	687	WP_015059009.1	PAS domain-containing protein	-
MU289_RS27445	83886..84113	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	catA2 / tet(A) / dfrA1 / qacE / sul1 / mph(A) / aph(3')-Ia / blaCTX-M-65 / fosA3 / blaTEM-1B / rmtB / blaKPC-2	-	1..173108	173108

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T241719 WP_001372321.1 NZ_CP095235:79043-79168 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

>T241719 NZ_OD940440:2717638-2717781 [Enterococcus faecalis]
ATGAATGTAAGTACTAAAATCTATGAAAGGAGAGGCCTTTTGTCAGCATATGAAACAATTCAGACAATTCTTGGGTTTGG
TATGTTTACCATTGCTTTGATTGCGCTGATTGTGAAATTGCTTAAAAATGACAAGAAAAAATAA

Antitoxin

Nucleotide

• Length: 66 bp

>AT241719 NZ_CP095235:c78964-78899 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin