Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2556456..2556640 | Replicon | chromosome |
Accession | NZ_CP095119 | ||
Organism | Staphylococcus aureus strain IVB6154 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2K4AFL5 |
Locus tag | MUA68_RS13105 | Protein ID | WP_000482651.1 |
Coordinates | 2556533..2556640 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2556456..2556516 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MUA68_RS13095 | 2552448..2554180 | - | 1733 | Protein_2541 | ABC transporter ATP-binding protein/permease | - |
MUA68_RS13100 | 2554205..2555968 | - | 1764 | WP_262520678.1 | ABC transporter ATP-binding protein | - |
- | 2556456..2556516 | + | 61 | - | - | Antitoxin |
MUA68_RS13105 | 2556533..2556640 | - | 108 | WP_000482651.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
MUA68_RS13110 | 2556774..2557160 | - | 387 | WP_262520679.1 | flippase GtxA | - |
MUA68_RS13115 | 2557428..2558570 | + | 1143 | WP_262520680.1 | glycerate kinase | - |
MUA68_RS13120 | 2558630..2559289 | + | 660 | WP_000831298.1 | membrane protein | - |
MUA68_RS13125 | 2559472..2560683 | + | 1212 | WP_234727756.1 | multidrug effflux MFS transporter | - |
MUA68_RS13130 | 2560806..2561279 | - | 474 | WP_262520682.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3984.75 Da Isoelectric Point: 11.0582
>T241403 WP_000482651.1 NZ_CP095119:c2556640-2556533 [Staphylococcus aureus]
MFNLLINIMTSAISGCLVAFFAHWLRTRSNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRSNKKGDK
Download Length: 108 bp
>T241403 NZ_LT992462:c1839425-1839330 [Staphylococcus aureus]
ATGTTGGAAATCCTTGTTCACATCACGACCACAGTCATCAGTGGTTGTATTATTGCGTTATTTACGCATTGGCTGCGTAA
TCGCAAAGACAAATAG
ATGTTGGAAATCCTTGTTCACATCACGACCACAGTCATCAGTGGTTGTATTATTGCGTTATTTACGCATTGGCTGCGTAA
TCGCAAAGACAAATAG
Antitoxin
Download Length: 61 bp
>AT241403 NZ_CP095119:2556456-2556516 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTATTGCAGTAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTATTGCAGTAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|