Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1928639..1928819 | Replicon | chromosome |
Accession | NZ_CP095119 | ||
Organism | Staphylococcus aureus strain IVB6154 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | MUA68_RS09625 | Protein ID | WP_001801861.1 |
Coordinates | 1928639..1928734 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1928762..1928819 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MUA68_RS09580 | 1924022..1925017 | + | 996 | WP_262520204.1 | DUF4352 domain-containing protein | - |
MUA68_RS09585 | 1925093..1925719 | + | 627 | WP_262520205.1 | hypothetical protein | - |
MUA68_RS09590 | 1925760..1926107 | + | 348 | WP_262520207.1 | DUF3969 family protein | - |
MUA68_RS09595 | 1926180..1926752 | + | 573 | Protein_1893 | hypothetical protein | - |
MUA68_RS09600 | 1927082..1927267 | - | 186 | WP_262522093.1 | hypothetical protein | - |
MUA68_RS09605 | 1927269..1927445 | - | 177 | WP_154285032.1 | hypothetical protein | - |
MUA68_RS09610 | 1927456..1927781 | - | 326 | Protein_1896 | hypothetical protein | - |
MUA68_RS09615 | 1927808..1928113 | - | 306 | WP_233682504.1 | IS3 family transposase | - |
MUA68_RS09620 | 1928155..1928391 | - | 237 | WP_262520211.1 | hypothetical protein | - |
MUA68_RS09625 | 1928639..1928734 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1928762..1928819 | - | 58 | - | - | Antitoxin |
MUA68_RS09630 | 1928857..1928958 | + | 102 | WP_262520213.1 | hypothetical protein | - |
MUA68_RS09635 | 1928936..1929112 | - | 177 | Protein_1901 | transposase | - |
MUA68_RS09640 | 1929280..1929723 | - | 444 | WP_262520214.1 | DUF1433 domain-containing protein | - |
MUA68_RS09645 | 1929723..1930166 | - | 444 | WP_262520215.1 | DUF1433 domain-containing protein | - |
MUA68_RS09650 | 1930166..1930609 | - | 444 | Protein_1904 | DUF1433 domain-containing protein | - |
MUA68_RS09655 | 1931137..1933557 | + | 2421 | WP_262520216.1 | polysaccharide lyase 8 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1928155..1928391 | 236 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T241392 WP_001801861.1 NZ_CP095119:1928639-1928734 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T241392 NZ_LT992461:c1862327-1862139 [Staphylococcus aureus]
ATGTCTTTACATTTTGCAATTCTGTTTTGGCTAGCATTAATTTTCTTAGTTGCCGCTACGTTTATACTCGTATTAATGAA
AAAAACTGGCAAAGAATCTAAAAAAGAGTCCTATTTAAGTTTCACTGTCATTCTCTATATTTTTGGATTCGCTATATTAA
TATACACATTTATATTTGGTGTGCTATAA
ATGTCTTTACATTTTGCAATTCTGTTTTGGCTAGCATTAATTTTCTTAGTTGCCGCTACGTTTATACTCGTATTAATGAA
AAAAACTGGCAAAGAATCTAAAAAAGAGTCCTATTTAAGTTTCACTGTCATTCTCTATATTTTTGGATTCGCTATATTAA
TATACACATTTATATTTGGTGTGCTATAA
Antitoxin
Download Length: 58 bp
>AT241392 NZ_CP095119:c1928819-1928762 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACCATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACCATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|