Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 1994131..1994357 | Replicon | chromosome |
| Accession | NZ_CP095116 | ||
| Organism | Staphylococcus aureus strain IVB6156 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | - |
| Locus tag | MUA78_RS09835 | Protein ID | WP_057488488.1 |
| Coordinates | 1994253..1994357 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF2 | ||
| Locus tag | - | ||
| Coordinates | 1994131..1994224 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MUA78_RS09790 (1990299) | 1990299..1990613 | + | 315 | WP_000274032.1 | hypothetical protein | - |
| MUA78_RS09795 (1990619) | 1990619..1990758 | - | 140 | Protein_1895 | hypothetical protein | - |
| MUA78_RS09800 (1991437) | 1991437..1991622 | - | 186 | WP_001286805.1 | hypothetical protein | - |
| MUA78_RS09805 (1991624) | 1991624..1991734 | - | 111 | WP_000139425.1 | hypothetical protein | - |
| MUA78_RS09810 (1991805) | 1991805..1991957 | - | 153 | WP_001788502.1 | hypothetical protein | - |
| MUA78_RS09815 (1992347) | 1992347..1992838 | - | 492 | WP_250406032.1 | staphylokinase | - |
| MUA78_RS09820 (1993029) | 1993029..1993784 | - | 756 | WP_262515136.1 | CHAP domain-containing protein | - |
| MUA78_RS09825 (1993796) | 1993796..1994050 | - | 255 | WP_000611512.1 | phage holin | - |
| MUA78_RS09830 (1994102) | 1994102..1994197 | + | 96 | Protein_1902 | hypothetical protein | - |
| - (1994131) | 1994131..1994224 | + | 94 | NuclAT_1 | - | Antitoxin |
| - (1994131) | 1994131..1994224 | + | 94 | NuclAT_1 | - | Antitoxin |
| - (1994131) | 1994131..1994224 | + | 94 | NuclAT_1 | - | Antitoxin |
| - (1994131) | 1994131..1994224 | + | 94 | NuclAT_1 | - | Antitoxin |
| MUA78_RS09835 (1994253) | 1994253..1994357 | - | 105 | WP_057488488.1 | hypothetical protein | Toxin |
| MUA78_RS09840 (1994563) | 1994563..1994862 | - | 300 | WP_107240626.1 | DUF2951 family protein | - |
| MUA78_RS09845 (1994901) | 1994901..1995062 | - | 162 | WP_250406035.1 | hypothetical protein | - |
| MUA78_RS09850 (1995049) | 1995049..1997235 | - | 2187 | WP_262515137.1 | phage tail protein | - |
| MUA78_RS09855 (1997251) | 1997251..1998366 | - | 1116 | WP_250406037.1 | hypothetical protein | - |
| MUA78_RS09860 (1998383) | 1998383..1999336 | - | 954 | WP_250406038.1 | phage tail family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | sak / vWbp / vWbp | 1991437..2079105 | 87668 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3919.77 Da Isoelectric Point: 5.5724
>T241368 WP_057488488.1 NZ_CP095116:c1994357-1994253 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISNQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISNQDHKK
Download Length: 105 bp
>T241368 NZ_LT992458:922523-922630 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 94 bp
>AT241368 NZ_CP095116:1994131-1994224 [Staphylococcus aureus]
ATATATAGGAAAAGGGCAACATGCGGAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTTTTCATAGAAAAA
TTATAAAAATAACC
ATATATAGGAAAAGGGCAACATGCGGAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTTTTCATAGAAAAA
TTATAAAAATAACC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
