Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1949618..1949798 | Replicon | chromosome |
Accession | NZ_CP095112 | ||
Organism | Staphylococcus aureus strain IVB6157 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | MUA55_RS09520 | Protein ID | WP_001801861.1 |
Coordinates | 1949618..1949713 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1949741..1949798 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MUA55_RS09495 (MUA55_09500) | 1944666..1946033 | - | 1368 | WP_001093574.1 | FRG domain-containing protein | - |
MUA55_RS09500 (MUA55_09505) | 1946033..1946464 | - | 432 | WP_262518258.1 | ImmA/IrrE family metallo-endopeptidase | - |
MUA55_RS09505 (MUA55_09510) | 1946457..1948103 | - | 1647 | WP_000277741.1 | IS1182-like element ISSau3 family transposase | - |
MUA55_RS09510 (MUA55_09515) | 1948346..1948528 | - | 183 | WP_262518259.1 | hypothetical protein | - |
MUA55_RS09515 (MUA55_09520) | 1948721..1949167 | - | 447 | WP_000747804.1 | DUF1433 domain-containing protein | - |
MUA55_RS09520 (MUA55_09525) | 1949618..1949713 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1949741..1949798 | - | 58 | - | - | Antitoxin |
MUA55_RS09525 (MUA55_09530) | 1949836..1949937 | + | 102 | WP_001791232.1 | hypothetical protein | - |
MUA55_RS09530 (MUA55_09535) | 1950112..1950555 | - | 444 | WP_001037039.1 | DUF1433 domain-containing protein | - |
MUA55_RS09535 (MUA55_09540) | 1950555..1950998 | - | 444 | WP_000731421.1 | DUF1433 domain-containing protein | - |
MUA55_RS09540 (MUA55_09545) | 1950998..1951440 | - | 443 | Protein_1878 | DUF1433 domain-containing protein | - |
MUA55_RS09545 (MUA55_09550) | 1951965..1954385 | + | 2421 | WP_252559462.1 | polysaccharide lyase 8 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1946457..1948103 | 1646 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T241350 WP_001801861.1 NZ_CP095112:1949618-1949713 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T241350 NZ_LT992436:c890172-890020 [Staphylococcus aureus]
ATGTCTAAAGACAAAGATCCAAAATTAAATTATCATGAAGAAGAAAACAGTATGGTAACTGATTTTGAAGATTTAAAAGA
ATTAGGTAAAGAAATGGAACAAATTTCTGATCAAAATGATCAAGAAAAGAATTCTGAAGAAGAGAGTCAGTAA
ATGTCTAAAGACAAAGATCCAAAATTAAATTATCATGAAGAAGAAAACAGTATGGTAACTGATTTTGAAGATTTAAAAGA
ATTAGGTAAAGAAATGGAACAAATTTCTGATCAAAATGATCAAGAAAAGAATTCTGAAGAAGAGAGTCAGTAA
Antitoxin
Download Length: 58 bp
>AT241350 NZ_CP095112:c1949798-1949741 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|