Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 1582786..1583077 | Replicon | chromosome |
| Accession | NZ_CP095112 | ||
| Organism | Staphylococcus aureus strain IVB6157 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | - |
| Locus tag | MUA55_RS07580 | Protein ID | WP_252559492.1 |
| Coordinates | 1582901..1583077 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 1582786..1582842 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MUA55_RS07540 (MUA55_07545) | 1577861..1578007 | - | 147 | WP_001033756.1 | hypothetical protein | - |
| MUA55_RS07545 (MUA55_07550) | 1578000..1578914 | - | 915 | WP_000476887.1 | DUF1672 domain-containing protein | - |
| MUA55_RS07550 (MUA55_07555) | 1578972..1579877 | - | 906 | WP_000913238.1 | DUF1672 domain-containing protein | - |
| MUA55_RS07555 (MUA55_07560) | 1579967..1580182 | - | 216 | WP_262518166.1 | hypothetical protein | - |
| MUA55_RS07560 (MUA55_07565) | 1580995..1581486 | - | 492 | WP_252559491.1 | staphylokinase | - |
| MUA55_RS07565 (MUA55_07570) | 1581676..1582431 | - | 756 | WP_252559490.1 | CHAP domain-containing protein | - |
| MUA55_RS07570 (MUA55_07575) | 1582443..1582697 | - | 255 | WP_238522769.1 | phage holin | - |
| MUA55_RS07575 (MUA55_07580) | 1582749..1582849 | + | 101 | Protein_1486 | hypothetical protein | - |
| - | 1582786..1582842 | + | 57 | - | - | Antitoxin |
| MUA55_RS07580 (MUA55_07585) | 1582901..1583077 | - | 177 | WP_252559492.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| MUA55_RS07585 (MUA55_07590) | 1583278..1584057 | - | 780 | WP_262518171.1 | exotoxin | - |
| MUA55_RS07590 (MUA55_07595) | 1584512..1584886 | - | 375 | WP_252559488.1 | hypothetical protein | - |
| MUA55_RS07595 (MUA55_07600) | 1584942..1585229 | - | 288 | WP_162636283.1 | hypothetical protein | - |
| MUA55_RS07600 (MUA55_07605) | 1585275..1585427 | - | 153 | WP_001153681.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | sak / sea / gnd | 1576866..1649101 | 72235 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6818.48 Da Isoelectric Point: 10.9678
>T241347 WP_252559492.1 NZ_CP095112:c1583077-1582901 [Staphylococcus aureus]
MDRWRLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSIKK
MDRWRLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSIKK
Download Length: 177 bp
>T241347 NZ_LT992435:c1446745-1446638 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 57 bp
>AT241347 NZ_CP095112:1582786-1582842 [Staphylococcus aureus]
AAAAGGGCAACATGCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AAAAGGGCAACATGCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|