Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Gp49-HTH_37 |
Location | 2189610..2190478 | Replicon | chromosome |
Accession | NZ_CP095020 | ||
Organism | Mycobacterium tuberculosis strain SGF0232017 |
Toxin (Protein)
Gene name | higB | Uniprot ID | P9WJA4 |
Locus tag | MUW65_RS10205 | Protein ID | WP_010886136.1 |
Coordinates | 2189610..2189987 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | G0TLM0 |
Locus tag | MUW65_RS10210 | Protein ID | WP_003409886.1 |
Coordinates | 2190029..2190478 (+) | Length | 150 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MUW65_RS10155 (MUW65_10155) | 2185399..2185851 | - | 453 | WP_003899095.1 | lipoprotein | - |
MUW65_RS10160 (MUW65_10160) | 2185915..2186316 | + | 402 | WP_003409869.1 | hypothetical protein | - |
MUW65_RS10165 (MUW65_10165) | 2186309..2186491 | - | 183 | WP_003409870.1 | hypothetical protein | - |
MUW65_RS10170 (MUW65_10170) | 2186605..2186955 | - | 351 | WP_003409871.1 | hypothetical protein | - |
MUW65_RS10175 (MUW65_10175) | 2186966..2187868 | - | 903 | WP_003899097.1 | hypothetical protein | - |
MUW65_RS10180 (MUW65_10180) | 2187889..2188080 | - | 192 | WP_003409876.1 | hypothetical protein | - |
MUW65_RS10185 (MUW65_10185) | 2188081..2188377 | - | 297 | WP_003409877.1 | hypothetical protein | - |
MUW65_RS10190 (MUW65_10190) | 2188617..2188832 | + | 216 | WP_003409878.1 | antitoxin | - |
MUW65_RS10195 (MUW65_10195) | 2188829..2189140 | + | 312 | WP_003409881.1 | type II toxin-antitoxin system VapC family toxin | - |
MUW65_RS10200 (MUW65_10200) | 2189114..2189635 | - | 522 | WP_003904745.1 | hypothetical protein | - |
MUW65_RS10205 (MUW65_10205) | 2189610..2189987 | + | 378 | WP_010886136.1 | type II toxin-antitoxin system toxin HigB | Toxin |
MUW65_RS10210 (MUW65_10210) | 2190029..2190478 | + | 450 | WP_003409886.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
MUW65_RS10215 (MUW65_10215) | 2190475..2191020 | + | 546 | WP_003409891.1 | SecB-like chaperone | - |
MUW65_RS10220 (MUW65_10220) | 2190909..2191523 | - | 615 | WP_003901296.1 | hypothetical protein | - |
MUW65_RS10225 (MUW65_10225) | 2191572..2191868 | - | 297 | WP_003409896.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
MUW65_RS10230 (MUW65_10230) | 2191865..2192116 | - | 252 | WP_003409899.1 | type II toxin-antitoxin system ParD family antitoxin | - |
MUW65_RS10235 (MUW65_10235) | 2192103..2192597 | + | 495 | WP_003899099.1 | hypothetical protein | - |
MUW65_RS10240 (MUW65_10240) | 2192757..2193164 | - | 408 | WP_003409913.1 | type II toxin-antitoxin system VapC family toxin | - |
MUW65_RS10245 (MUW65_10245) | 2193168..2193440 | - | 273 | WP_003899100.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
MUW65_RS10250 (MUW65_10250) | 2193473..2194693 | - | 1221 | WP_003409919.1 | TetR family transcriptional regulator Mce3R | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14397.77 Da Isoelectric Point: 10.8862
>T240981 WP_010886136.1 NZ_CP095020:2189610-2189987 [Mycobacterium tuberculosis]
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLF
FRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLF
FRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
Download Length: 378 bp
>T240981 NZ_LT903847:1014200-1014307 [Escherichia coli O127:H6]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGTTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGTTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 150 a.a. Molecular weight: 16760.16 Da Isoelectric Point: 8.0771
>AT240981 WP_003409886.1 NZ_CP095020:2190029-2190478 [Mycobacterium tuberculosis]
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLS
TLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVA
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLS
TLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVA
Download Length: 450 bp
>AT240981 NZ_LT903847:c1014152-1014086 [Escherichia coli O127:H6]
GGTCTAGATGCAAGAATGGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GGTCTAGATGCAAGAATGGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|