Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2346235..2346452 | Replicon | chromosome |
Accession | NZ_CP094855 | ||
Organism | Staphylococcus aureus strain NY2491 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | MTX64_RS11915 | Protein ID | WP_001802298.1 |
Coordinates | 2346348..2346452 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF4 | ||
Locus tag | - | ||
Coordinates | 2346235..2346290 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MTX64_RS11890 | 2342372..2343037 | - | 666 | WP_001024094.1 | SDR family oxidoreductase | - |
MTX64_RS11895 | 2343189..2343509 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
MTX64_RS11900 | 2343511..2344491 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
MTX64_RS11905 | 2344757..2345848 | + | 1092 | WP_000495671.1 | lytic regulatory protein | - |
- | 2346235..2346290 | + | 56 | - | - | Antitoxin |
MTX64_RS11915 | 2346348..2346452 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
MTX64_RS11920 | 2346613..2347096 | - | 484 | Protein_2317 | recombinase family protein | - |
MTX64_RS11925 | 2347139..2348275 | - | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
MTX64_RS11930 | 2348564..2348656 | + | 93 | WP_031872195.1 | hypothetical protein | - |
MTX64_RS11940 | 2349361..2350218 | - | 858 | WP_000370924.1 | HAD family hydrolase | - |
MTX64_RS11945 | 2350286..2351068 | - | 783 | WP_000908176.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T240689 WP_001802298.1 NZ_CP094855:c2346452-2346348 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T240689 NZ_LT615377:c1297230-1297123 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 56 bp
>AT240689 NZ_CP094855:2346235-2346290 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|