Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2301674..2301891 | Replicon | chromosome |
Accession | NZ_CP094853 | ||
Organism | Staphylococcus aureus strain NY2010 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | MTX62_RS11610 | Protein ID | WP_001802298.1 |
Coordinates | 2301787..2301891 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF4 | ||
Locus tag | - | ||
Coordinates | 2301674..2301729 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MTX62_RS11585 | 2297811..2298476 | - | 666 | WP_001024094.1 | SDR family oxidoreductase | - |
MTX62_RS11590 | 2298628..2298948 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
MTX62_RS11595 | 2298950..2299930 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
MTX62_RS11600 | 2300196..2301287 | + | 1092 | WP_000495671.1 | lytic regulatory protein | - |
- | 2301674..2301729 | + | 56 | - | - | Antitoxin |
MTX62_RS11610 | 2301787..2301891 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
MTX62_RS11615 | 2302052..2302535 | - | 484 | Protein_2258 | recombinase family protein | - |
MTX62_RS11620 | 2302578..2303714 | - | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
MTX62_RS11625 | 2304003..2304095 | + | 93 | WP_031872195.1 | hypothetical protein | - |
MTX62_RS11635 | 2304800..2305657 | - | 858 | WP_000370924.1 | HAD family hydrolase | - |
MTX62_RS11640 | 2305725..2306507 | - | 783 | WP_000908176.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T240670 WP_001802298.1 NZ_CP094853:c2301891-2301787 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T240670 NZ_LT615218:c2164451-2164347 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT240670 NZ_CP094853:2301674-2301729 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|