Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1892744..1892924 | Replicon | chromosome |
Accession | NZ_CP094797 | ||
Organism | Staphylococcus aureus strain IVB6163 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | MUA16_RS09100 | Protein ID | WP_262519341.1 |
Coordinates | 1892744..1892839 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1892867..1892924 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MUA16_RS09070 | 1887888..1888514 | + | 627 | WP_000669038.1 | hypothetical protein | - |
MUA16_RS09075 | 1888555..1888899 | + | 345 | WP_000627550.1 | DUF3969 family protein | - |
MUA16_RS09080 | 1888997..1889569 | + | 573 | WP_000414222.1 | hypothetical protein | - |
MUA16_RS09085 | 1889718..1891085 | - | 1368 | WP_001093574.1 | FRG domain-containing protein | - |
MUA16_RS09090 | 1891085..1891654 | - | 570 | WP_000125075.1 | ImmA/IrrE family metallo-endopeptidase | - |
MUA16_RS09095 | 1891847..1892293 | - | 447 | WP_000747804.1 | DUF1433 domain-containing protein | - |
MUA16_RS09100 | 1892744..1892839 | + | 96 | WP_262519341.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 1892867..1892924 | - | 58 | - | - | Antitoxin |
MUA16_RS09105 | 1892962..1893063 | + | 102 | WP_001791232.1 | hypothetical protein | - |
MUA16_RS09110 | 1893238..1893681 | - | 444 | WP_001037039.1 | DUF1433 domain-containing protein | - |
MUA16_RS09115 | 1893681..1894124 | - | 444 | WP_000731421.1 | DUF1433 domain-containing protein | - |
MUA16_RS09120 | 1894124..1894566 | - | 443 | Protein_1794 | DUF1433 domain-containing protein | - |
MUA16_RS09125 | 1895091..1897511 | + | 2421 | WP_262515765.1 | polysaccharide lyase 8 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3582.37 Da Isoelectric Point: 10.4449
>T240489 WP_262519341.1 NZ_CP094797:1892744-1892839 [Staphylococcus aureus]
VMLIFVHIIVPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIVPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T240489 NZ_LT556084:2760552-2760655 [Citrobacter amalonaticus]
GGCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTATTCGGTCTCTTTTT
GGCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: 58 bp
>AT240489 NZ_CP094797:c1892924-1892867 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|