Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2435343..2435527 | Replicon | chromosome |
Accession | NZ_CP094795 | ||
Organism | Staphylococcus aureus strain IVB6164 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | MUA75_RS12040 | Protein ID | WP_000482647.1 |
Coordinates | 2435420..2435527 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2435343..2435403 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MUA75_RS12025 (MUA75_12015) | 2430797..2430964 | - | 168 | WP_031927726.1 | hypothetical protein | - |
MUA75_RS12030 (MUA75_12020) | 2431195..2432928 | - | 1734 | WP_000486497.1 | ABC transporter ATP-binding protein | - |
MUA75_RS12035 (MUA75_12025) | 2432953..2434716 | - | 1764 | WP_252549861.1 | ABC transporter ATP-binding protein | - |
- | 2435343..2435403 | + | 61 | - | - | Antitoxin |
MUA75_RS12040 (MUA75_12030) | 2435420..2435527 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
MUA75_RS12045 (MUA75_12035) | 2435661..2436047 | - | 387 | WP_000779353.1 | flippase GtxA | - |
MUA75_RS12050 (MUA75_12040) | 2436315..2437457 | + | 1143 | WP_001176867.1 | glycerate kinase | - |
MUA75_RS12055 (MUA75_12045) | 2437517..2438176 | + | 660 | WP_000831298.1 | membrane protein | - |
MUA75_RS12060 (MUA75_12050) | 2438359..2439570 | + | 1212 | WP_001191927.1 | multidrug effflux MFS transporter | - |
MUA75_RS12065 (MUA75_12055) | 2439693..2440166 | - | 474 | WP_000456493.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T240480 WP_000482647.1 NZ_CP094795:c2435527-2435420 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T240480 NZ_CP094795:c2435527-2435420 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT240480 NZ_CP094795:2435343-2435403 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|