Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 1657483..1657774 | Replicon | chromosome |
| Accession | NZ_CP094785 | ||
| Organism | Staphylococcus aureus strain IVB6169 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | - |
| Locus tag | MUA79_RS08155 | Protein ID | WP_078061146.1 |
| Coordinates | 1657598..1657774 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 1657483..1657539 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MUA79_RS08125 (MUA79_08110) | 1653657..1654565 | - | 909 | WP_045178743.1 | DUF1672 domain-containing protein | - |
| MUA79_RS08130 (MUA79_08115) | 1654655..1654870 | - | 216 | WP_045178742.1 | hypothetical protein | - |
| MUA79_RS08135 (MUA79_08120) | 1655692..1656183 | - | 492 | WP_045178740.1 | staphylokinase | - |
| MUA79_RS08140 (MUA79_08125) | 1656373..1657128 | - | 756 | WP_045178739.1 | CHAP domain-containing protein | - |
| MUA79_RS08145 (MUA79_08130) | 1657140..1657394 | - | 255 | WP_045178738.1 | phage holin | - |
| MUA79_RS08150 (MUA79_08135) | 1657446..1657546 | + | 101 | Protein_1601 | hypothetical protein | - |
| - | 1657483..1657539 | + | 57 | - | - | Antitoxin |
| MUA79_RS08155 (MUA79_08140) | 1657598..1657774 | - | 177 | WP_078061146.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| MUA79_RS08160 (MUA79_08145) | 1657975..1658700 | - | 726 | Protein_1603 | exotoxin | - |
| MUA79_RS08165 (MUA79_08150) | 1658719..1660365 | - | 1647 | WP_000277741.1 | IS1182-like element ISSau3 family transposase | - |
| MUA79_RS08170 (MUA79_08155) | 1661125..1661493 | - | 369 | WP_135831022.1 | hypothetical protein | - |
| MUA79_RS08175 (MUA79_08160) | 1661588..1661875 | - | 288 | WP_001040260.1 | hypothetical protein | - |
| MUA79_RS08180 (MUA79_08165) | 1661922..1662074 | - | 153 | WP_001153680.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | sak / sea | 1653657..1711998 | 58341 | |
| - | flank | IS/Tn | - | - | 1658719..1660365 | 1646 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6848.50 Da Isoelectric Point: 10.6777
>T240400 WP_078061146.1 NZ_CP094785:c1657774-1657598 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSIKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSIKK
Download Length: 177 bp
>T240400 NZ_LS998786:100880-101038 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 57 bp
>AT240400 NZ_CP094785:1657483-1657539 [Staphylococcus aureus]
AAAAGGGCAACATGCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AAAAGGGCAACATGCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|