Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2544570..2544754 | Replicon | chromosome |
Accession | NZ_CP094778 | ||
Organism | Staphylococcus aureus strain IVB6185 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | MUA10_RS12735 | Protein ID | WP_000482647.1 |
Coordinates | 2544647..2544754 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2544570..2544630 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MUA10_RS12720 (MUA10_12715) | 2540080..2540247 | - | 168 | Protein_2459 | hypothetical protein | - |
MUA10_RS12725 (MUA10_12720) | 2540478..2542211 | - | 1734 | WP_262607407.1 | ABC transporter ATP-binding protein | - |
MUA10_RS12730 (MUA10_12725) | 2542236..2543999 | - | 1764 | WP_001064829.1 | ABC transporter ATP-binding protein | - |
- | 2544570..2544630 | + | 61 | - | - | Antitoxin |
MUA10_RS12735 (MUA10_12730) | 2544647..2544754 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
MUA10_RS12740 (MUA10_12735) | 2544888..2545274 | - | 387 | WP_000779351.1 | flippase GtxA | - |
MUA10_RS12745 (MUA10_12740) | 2545542..2546684 | + | 1143 | WP_001176855.1 | glycerate kinase | - |
MUA10_RS12750 (MUA10_12745) | 2546744..2547403 | + | 660 | WP_000831298.1 | membrane protein | - |
MUA10_RS12755 (MUA10_12750) | 2547585..2548796 | + | 1212 | WP_001191919.1 | multidrug effflux MFS transporter | - |
MUA10_RS12760 (MUA10_12755) | 2548919..2549392 | - | 474 | WP_000456496.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T240350 WP_000482647.1 NZ_CP094778:c2544754-2544647 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T240350 NZ_LS992194:c2706-2551 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTTACGAATCCGGTAA
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTTACGAATCCGGTAA
Antitoxin
Download Length: 61 bp
>AT240350 NZ_CP094778:2544570-2544630 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|