Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2498335..2498519 | Replicon | chromosome |
Accession | NZ_CP094772 | ||
Organism | Staphylococcus aureus strain IVB6196 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | MUA50_RS12575 | Protein ID | WP_000482647.1 |
Coordinates | 2498412..2498519 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2498335..2498395 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MUA50_RS12560 | 2493845..2494012 | - | 168 | Protein_2432 | hypothetical protein | - |
MUA50_RS12565 | 2494243..2495976 | - | 1734 | WP_000486505.1 | ABC transporter ATP-binding protein | - |
MUA50_RS12570 | 2496001..2497764 | - | 1764 | WP_001064829.1 | ABC transporter ATP-binding protein | - |
- | 2498335..2498395 | + | 61 | - | - | Antitoxin |
MUA50_RS12575 | 2498412..2498519 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
MUA50_RS12580 | 2498653..2499039 | - | 387 | WP_000779351.1 | flippase GtxA | - |
MUA50_RS12585 | 2499307..2500449 | + | 1143 | WP_001176855.1 | glycerate kinase | - |
MUA50_RS12590 | 2500509..2501168 | + | 660 | WP_262516001.1 | hypothetical protein | - |
MUA50_RS12595 | 2501350..2502561 | + | 1212 | WP_001191919.1 | multidrug effflux MFS transporter | - |
MUA50_RS12600 | 2502684..2503157 | - | 474 | WP_000456496.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T240305 WP_000482647.1 NZ_CP094772:c2498519-2498412 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T240305 NZ_LS992190:2284572-2284674 [Escherichia coli]
GCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTGTTCGGTCTCTTTTT
GCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTGTTCGGTCTCTTTTT
Antitoxin
Download Length: 61 bp
>AT240305 NZ_CP094772:2498335-2498395 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|