Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 944548..944728 | Replicon | chromosome |
Accession | NZ_CP094768 | ||
Organism | Staphylococcus aureus strain IVB6202 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | MUA94_RS04805 | Protein ID | WP_001801861.1 |
Coordinates | 944633..944728 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 944548..944605 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MUA94_RS04790 (MUA94_04780) | 939636..943747 | + | 4112 | Protein_902 | SMEK domain-containing protein | - |
MUA94_RS04795 (MUA94_04785) | 944255..944371 | + | 117 | Protein_903 | transposase | - |
MUA94_RS04800 (MUA94_04790) | 944409..944510 | - | 102 | WP_001791232.1 | hypothetical protein | - |
- | 944548..944605 | + | 58 | - | - | Antitoxin |
MUA94_RS04805 (MUA94_04795) | 944633..944728 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
MUA94_RS04810 (MUA94_04800) | 945180..945626 | + | 447 | WP_000747809.1 | DUF1433 domain-containing protein | - |
MUA94_RS04815 (MUA94_04805) | 946313..946696 | + | 384 | WP_000070811.1 | hypothetical protein | - |
MUA94_RS04820 (MUA94_04810) | 946707..946883 | + | 177 | WP_000375476.1 | hypothetical protein | - |
MUA94_RS04825 (MUA94_04815) | 946885..947070 | + | 186 | WP_000809858.1 | hypothetical protein | - |
MUA94_RS04830 (MUA94_04820) | 947876..948709 | - | 834 | WP_262538511.1 | ATP-binding cassette domain-containing protein | - |
MUA94_RS04835 (MUA94_04825) | 949085..949657 | - | 573 | WP_000414222.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T240273 WP_001801861.1 NZ_CP094768:c944728-944633 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T240273 NZ_LS992185:c2877501-2877398 [Escherichia coli]
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
Antitoxin
Download Length: 58 bp
>AT240273 NZ_CP094768:944548-944605 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|