Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2412684..2412868 | Replicon | chromosome |
Accession | NZ_CP094760 | ||
Organism | Staphylococcus aureus strain IVB6232 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | MUA14_RS11855 | Protein ID | WP_000482647.1 |
Coordinates | 2412761..2412868 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2412684..2412744 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MUA14_RS11840 (MUA14_11830) | 2408138..2408305 | - | 168 | WP_031927726.1 | hypothetical protein | - |
MUA14_RS11845 (MUA14_11835) | 2408536..2410269 | - | 1734 | WP_000486497.1 | ABC transporter ATP-binding protein | - |
MUA14_RS11850 (MUA14_11840) | 2410294..2412057 | - | 1764 | WP_252549861.1 | ABC transporter ATP-binding protein | - |
- | 2412684..2412744 | + | 61 | - | - | Antitoxin |
MUA14_RS11855 (MUA14_11845) | 2412761..2412868 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
MUA14_RS11860 (MUA14_11850) | 2413002..2413388 | - | 387 | WP_000779353.1 | flippase GtxA | - |
MUA14_RS11865 (MUA14_11855) | 2413656..2414798 | + | 1143 | WP_252549863.1 | glycerate kinase | - |
MUA14_RS11870 (MUA14_11860) | 2414858..2415517 | + | 660 | WP_262541395.1 | hypothetical protein | - |
MUA14_RS11875 (MUA14_11865) | 2415700..2416911 | + | 1212 | WP_252549865.1 | multidrug effflux MFS transporter | - |
MUA14_RS11880 (MUA14_11870) | 2417034..2417507 | - | 474 | WP_000456493.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T240235 WP_000482647.1 NZ_CP094760:c2412868-2412761 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T240235 NZ_LS992181:c124156-123998 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 61 bp
>AT240235 NZ_CP094760:2412684-2412744 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|