Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1957434..1957614 | Replicon | chromosome |
| Accession | NZ_CP094747 | ||
| Organism | Staphylococcus aureus strain IVB6249 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | MUA08_RS09655 | Protein ID | WP_001801861.1 |
| Coordinates | 1957434..1957529 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1957557..1957614 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MUA08_RS09630 (MUA08_09630) | 1952482..1953849 | - | 1368 | WP_001093574.1 | FRG domain-containing protein | - |
| MUA08_RS09635 (MUA08_09635) | 1953849..1954265 | - | 417 | WP_262628334.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MUA08_RS09640 (MUA08_09640) | 1954273..1955919 | - | 1647 | WP_000277741.1 | IS1182-like element ISSau3 family transposase | - |
| MUA08_RS09645 (MUA08_09645) | 1956162..1956344 | - | 183 | WP_262518259.1 | hypothetical protein | - |
| MUA08_RS09650 (MUA08_09650) | 1956537..1956983 | - | 447 | WP_000747804.1 | DUF1433 domain-containing protein | - |
| MUA08_RS09655 (MUA08_09655) | 1957434..1957529 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1957557..1957614 | - | 58 | - | - | Antitoxin |
| MUA08_RS09660 (MUA08_09660) | 1957652..1957753 | + | 102 | WP_001791232.1 | hypothetical protein | - |
| MUA08_RS09665 (MUA08_09665) | 1957928..1958371 | - | 444 | WP_001037039.1 | DUF1433 domain-containing protein | - |
| MUA08_RS09670 (MUA08_09670) | 1958371..1958814 | - | 444 | WP_000731421.1 | DUF1433 domain-containing protein | - |
| MUA08_RS09675 (MUA08_09675) | 1958814..1959256 | - | 443 | Protein_1905 | DUF1433 domain-containing protein | - |
| MUA08_RS09680 (MUA08_09680) | 1959781..1962201 | + | 2421 | WP_252559462.1 | polysaccharide lyase 8 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 1954273..1955919 | 1646 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T240152 WP_001801861.1 NZ_CP094747:1957434-1957529 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T240152 NZ_LS992168:2159817-2159919 [Escherichia coli]
GCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTGTTCGGTCTCTTTTT
GCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTGTTCGGTCTCTTTTT
Antitoxin
Download Length: 58 bp
>AT240152 NZ_CP094747:c1957614-1957557 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|