Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 1577041..1577332 | Replicon | chromosome |
Accession | NZ_CP094745 | ||
Organism | Staphylococcus aureus strain IVB6250 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | MUA64_RS07615 | Protein ID | WP_252559492.1 |
Coordinates | 1577156..1577332 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 1577041..1577097 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MUA64_RS07575 (MUA64_07575) | 1572116..1572268 | - | 153 | WP_172609139.1 | hypothetical protein | - |
MUA64_RS07580 (MUA64_07580) | 1572255..1573169 | - | 915 | WP_000476887.1 | DUF1672 domain-containing protein | - |
MUA64_RS07585 (MUA64_07585) | 1573227..1574132 | - | 906 | WP_000913238.1 | DUF1672 domain-containing protein | - |
MUA64_RS07590 (MUA64_07590) | 1574222..1574437 | - | 216 | WP_262518166.1 | hypothetical protein | - |
MUA64_RS07595 (MUA64_07595) | 1575250..1575741 | - | 492 | WP_252559491.1 | staphylokinase | - |
MUA64_RS07600 (MUA64_07600) | 1575931..1576686 | - | 756 | WP_252559490.1 | CHAP domain-containing protein | - |
MUA64_RS07605 (MUA64_07605) | 1576698..1576952 | - | 255 | WP_238522769.1 | phage holin | - |
MUA64_RS07610 (MUA64_07610) | 1577004..1577104 | + | 101 | Protein_1493 | hypothetical protein | - |
- | 1577041..1577097 | + | 57 | - | - | Antitoxin |
MUA64_RS07615 (MUA64_07615) | 1577156..1577332 | - | 177 | WP_252559492.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
MUA64_RS07620 (MUA64_07620) | 1577533..1578312 | - | 780 | WP_262518171.1 | exotoxin | - |
MUA64_RS07625 (MUA64_07625) | 1578767..1579141 | - | 375 | WP_252559488.1 | hypothetical protein | - |
MUA64_RS07630 (MUA64_07630) | 1579197..1579484 | - | 288 | WP_162636283.1 | hypothetical protein | - |
MUA64_RS07635 (MUA64_07635) | 1579530..1579682 | - | 153 | WP_001153681.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | sak / sea / gnd | 1574222..1643356 | 69134 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6818.48 Da Isoelectric Point: 10.9678
>T240137 WP_252559492.1 NZ_CP094745:c1577332-1577156 [Staphylococcus aureus]
MDRWRLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSIKK
MDRWRLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSIKK
Download Length: 177 bp
>T240137 NZ_LS992166:c4380304-4380131 [Escherichia coli]
ATGGCACTATTCTCTAAAATATTAATTTTTTATGTGATTGGTGTGAACATATCCTTTGTCATTATCTGGTTTATCTCACA
TGAGAAAACACATATTCGTTTACTTAGTGCATTCCTGGTCGGAATAACCTGGCCAATGAGTCTGCCTGTGGCATTACTTT
TTTCTCTCTTTTAG
ATGGCACTATTCTCTAAAATATTAATTTTTTATGTGATTGGTGTGAACATATCCTTTGTCATTATCTGGTTTATCTCACA
TGAGAAAACACATATTCGTTTACTTAGTGCATTCCTGGTCGGAATAACCTGGCCAATGAGTCTGCCTGTGGCATTACTTT
TTTCTCTCTTTTAG
Antitoxin
Download Length: 57 bp
>AT240137 NZ_CP094745:1577041-1577097 [Staphylococcus aureus]
AAAAGGGCAACATGCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AAAAGGGCAACATGCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|