Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 25252..25411 | Replicon | plasmid unnamed |
| Accession | NZ_CP094708 | ||
| Organism | Staphylococcus simulans strain IVB6192 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | MUA28_RS13155 | Protein ID | WP_262556599.1 |
| Coordinates | 25252..25347 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 25375..25411 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MUA28_RS13120 (20448) | 20448..21653 | - | 1206 | WP_262556591.1 | sodium/glutamate symporter | - |
| MUA28_RS13125 (22084) | 22084..22284 | + | 201 | WP_262556594.1 | cold-shock protein | - |
| MUA28_RS13130 (22541) | 22541..23422 | - | 882 | WP_262571979.1 | ISL3 family transposase | - |
| MUA28_RS13135 (23525) | 23525..23613 | - | 89 | Protein_30 | IS6 family transposase | - |
| MUA28_RS13140 (23670) | 23670..24344 | + | 675 | Protein_31 | IS6 family transposase | - |
| MUA28_RS13145 (24406) | 24406..24795 | - | 390 | WP_262556597.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
| MUA28_RS13150 (24813) | 24813..25058 | - | 246 | WP_262556598.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| MUA28_RS13155 (25252) | 25252..25347 | + | 96 | WP_262556599.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| - (25375) | 25375..25411 | - | 37 | NuclAT_0 | - | Antitoxin |
| - (25375) | 25375..25411 | - | 37 | NuclAT_0 | - | Antitoxin |
| - (25375) | 25375..25411 | - | 37 | NuclAT_0 | - | Antitoxin |
| MUA28_RS13160 (25492) | 25492..25630 | - | 139 | Protein_35 | IS6 family transposase | - |
| MUA28_RS13165 (25819) | 25819..26493 | - | 675 | WP_262556601.1 | IS6 family transposase | - |
| MUA28_RS13170 (26523) | 26523..27362 | - | 840 | WP_262556602.1 | protein rep | - |
| MUA28_RS13175 (27855) | 27855..28400 | - | 546 | WP_262556603.1 | hypothetical protein | - |
| MUA28_RS13180 (28732) | 28732..28896 | - | 165 | WP_262571933.1 | hypothetical protein | - |
| MUA28_RS13185 (29546) | 29546..30221 | - | 676 | Protein_40 | IS6 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3592.32 Da Isoelectric Point: 9.7333
>T240027 WP_262556599.1 NZ_CP094708:25252-25347 [Staphylococcus simulans]
MYIIFVHIIAPVISGCAVAYFTYWLSSKRNK
MYIIFVHIIAPVISGCAVAYFTYWLSSKRNK
Download Length: 96 bp
>T240027 NZ_LS483470:1250684-1250863 [Leminorella richardii]
ATGGACAGCAAAAATGTAATAGCCATGATTGAGGCCGACGGATGGTATTTGGTTCGTATTAAAGGCAGTCATCATCAGTT
TAAGCATCCGCTAAAAAAGGGGCTGGTAACGGTAAAACATACACAAAAGGACATTCCGTTACCCACTCTAAAAAGTATTA
AAAGGCAGTCGGGAATTTAG
ATGGACAGCAAAAATGTAATAGCCATGATTGAGGCCGACGGATGGTATTTGGTTCGTATTAAAGGCAGTCATCATCAGTT
TAAGCATCCGCTAAAAAAGGGGCTGGTAACGGTAAAACATACACAAAAGGACATTCCGTTACCCACTCTAAAAAGTATTA
AAAGGCAGTCGGGAATTTAG
Antitoxin
Download Length: 37 bp
>AT240027 NZ_CP094708:c25411-25375 [Staphylococcus simulans]
ATGCACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ATGCACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
