Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 13072..13325 | Replicon | plasmid pST3606-2 |
| Accession | NZ_CP094334 | ||
| Organism | Salmonella enterica subsp. enterica strain 3018683606 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | MQF88_RS25155 | Protein ID | WP_001312851.1 |
| Coordinates | 13072..13221 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 13266..13325 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MQF88_RS25115 (8431) | 8431..8846 | - | 416 | Protein_12 | IS1-like element IS1B family transposase | - |
| MQF88_RS25120 (9095) | 9095..9496 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| MQF88_RS25125 (9429) | 9429..9686 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| MQF88_RS25130 (9779) | 9779..10432 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| MQF88_RS25135 (11371) | 11371..12228 | - | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| MQF88_RS25610 (12221) | 12221..12295 | - | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| MQF88_RS25150 (12540) | 12540..12788 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| MQF88_RS25155 (13072) | 13072..13221 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (13266) | 13266..13325 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (13266) | 13266..13325 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (13266) | 13266..13325 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (13266) | 13266..13325 | + | 60 | NuclAT_1 | - | Antitoxin |
| MQF88_RS25160 (13526) | 13526..13756 | - | 231 | WP_001736714.1 | hypothetical protein | - |
| MQF88_RS25165 (13920) | 13920..14519 | - | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| MQF88_RS25170 (14905) | 14905..15105 | - | 201 | WP_015059022.1 | hypothetical protein | - |
| MQF88_RS25175 (15237) | 15237..15797 | - | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| MQF88_RS25180 (15852) | 15852..16598 | - | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / aac(3)-IId | - | 1..70455 | 70455 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T239696 WP_001312851.1 NZ_CP094334:c13221-13072 [Salmonella enterica subsp. enterica]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T239696 NZ_LS483303:c4181376-4181203 [Escherichia coli]
ATGGCACTATTCTCTAAAATATTAATTTTTTATGTGATTGGTGTGAACATATCCTTTGTCATTATCTGGTTTATCTCACA
TGAGAAAACACATATTCGTTTACTTAGTGCATTCCTGGTCGGAATAACCTGGCCAATGAGTCTGCCTGTGGCATTACTTT
TTTCTCTCTTTTAG
ATGGCACTATTCTCTAAAATATTAATTTTTTATGTGATTGGTGTGAACATATCCTTTGTCATTATCTGGTTTATCTCACA
TGAGAAAACACATATTCGTTTACTTAGTGCATTCCTGGTCGGAATAACCTGGCCAATGAGTCTGCCTGTGGCATTACTTT
TTTCTCTCTTTTAG
Antitoxin
Download Length: 60 bp
>AT239696 NZ_CP094334:13266-13325 [Salmonella enterica subsp. enterica]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
