Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 32738..33002 | Replicon | plasmid pST3606-1 |
| Accession | NZ_CP094333 | ||
| Organism | Salmonella enterica subsp. enterica strain 3018683606 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | E6BRV3 |
| Locus tag | MQF88_RS24615 | Protein ID | WP_001303307.1 |
| Coordinates | 32738..32890 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 32940..33002 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MQF88_RS24590 (27943) | 27943..30110 | + | 2168 | Protein_28 | IncI1-type conjugal transfer membrane protein TraY | - |
| MQF88_RS24595 (30186) | 30186..30799 | + | 614 | Protein_29 | plasmid IncI1-type surface exclusion protein ExcA | - |
| MQF88_RS24600 (30897) | 30897..31106 | + | 210 | WP_001140545.1 | hemolysin expression modulator Hha | - |
| MQF88_RS24605 (31315) | 31315..31491 | + | 177 | WP_001054900.1 | hypothetical protein | - |
| - (31977) | 31977..32028 | + | 52 | NuclAT_2 | - | - |
| - (31977) | 31977..32028 | + | 52 | NuclAT_2 | - | - |
| - (31977) | 31977..32028 | + | 52 | NuclAT_2 | - | - |
| - (31977) | 31977..32028 | + | 52 | NuclAT_2 | - | - |
| MQF88_RS24610 (32415) | 32415..32666 | + | 252 | WP_001291968.1 | hypothetical protein | - |
| MQF88_RS24615 (32738) | 32738..32890 | - | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
| - (32940) | 32940..33002 | + | 63 | NuclAT_0 | - | Antitoxin |
| - (32940) | 32940..33002 | + | 63 | NuclAT_0 | - | Antitoxin |
| - (32940) | 32940..33002 | + | 63 | NuclAT_0 | - | Antitoxin |
| - (32940) | 32940..33002 | + | 63 | NuclAT_0 | - | Antitoxin |
| MQF88_RS24620 (33211) | 33211..33417 | + | 207 | WP_001387488.1 | hypothetical protein | - |
| MQF88_RS24625 (33516) | 33516..34293 | + | 778 | Protein_35 | protein FinQ | - |
| - (34360) | 34360..34420 | + | 61 | NuclAT_1 | - | - |
| - (34360) | 34360..34420 | + | 61 | NuclAT_1 | - | - |
| - (34360) | 34360..34420 | + | 61 | NuclAT_1 | - | - |
| - (34360) | 34360..34420 | + | 61 | NuclAT_1 | - | - |
| MQF88_RS24630 (34600) | 34600..35808 | + | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| MQF88_RS24635 (35827) | 35827..36897 | + | 1071 | WP_000151582.1 | IncI1-type conjugal transfer protein TrbB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaNDM-5 / sul1 / qacE / aadA2 / dfrA12 | - | 1..109070 | 109070 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T239692 WP_001303307.1 NZ_CP094333:c32890-32738 [Salmonella enterica subsp. enterica]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T239692 NZ_LS483303:2593499-2593606 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 63 bp
>AT239692 NZ_CP094333:32940-33002 [Salmonella enterica subsp. enterica]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|