Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 65053..65322 | Replicon | plasmid pNY1688-1 |
Accession | NZ_CP094273 | ||
Organism | Klebsiella aerogenes strain NY1688 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | MQE04_RS26315 | Protein ID | WP_001372321.1 |
Coordinates | 65197..65322 (+) | Length | 42 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 65053..65118 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MQE04_RS26285 | 60763..61290 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
MQE04_RS26290 | 61348..61581 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
MQE04_RS26295 | 61642..63665 | + | 2024 | Protein_84 | ParB/RepB/Spo0J family partition protein | - |
MQE04_RS26300 | 63734..64168 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
MQE04_RS26305 | 64165..64884 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- | 64896..65120 | + | 225 | NuclAT_0 | - | - |
- | 64896..65120 | + | 225 | NuclAT_0 | - | - |
- | 64896..65120 | + | 225 | NuclAT_0 | - | - |
- | 64896..65120 | + | 225 | NuclAT_0 | - | - |
- | 65053..65118 | - | 66 | - | - | Antitoxin |
MQE04_RS26310 | 65106..65255 | + | 150 | Protein_87 | plasmid maintenance protein Mok | - |
MQE04_RS26315 | 65197..65322 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
MQE04_RS26320 | 65641..65937 | - | 297 | Protein_89 | hypothetical protein | - |
MQE04_RS26325 | 66237..66533 | + | 297 | WP_001272251.1 | hypothetical protein | - |
MQE04_RS26330 | 66644..67465 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
MQE04_RS26335 | 67762..68352 | - | 591 | WP_000252683.1 | transglycosylase SLT domain-containing protein | - |
MQE04_RS26340 | 68687..69070 | + | 384 | WP_001354030.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
MQE04_RS26345 | 69264..69935 | + | 672 | WP_000283561.1 | conjugal transfer transcriptional regulator TraJ | - |
MQE04_RS26350 | 70072..70299 | + | 228 | WP_000089263.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaTEM-1B / dfrA25 / qacE / sul1 / mph(A) / blaKPC-2 | - | 1..106628 | 106628 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T239439 WP_001372321.1 NZ_CP094273:65197-65322 [Klebsiella aerogenes]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
>T239439 NZ_LR890714:c4730844-4730671 [Escherichia coli]
ATGGCACTATTCTCTAAAATATTAATTTTTTATGTGATTGGTGTGAACATATCCTTTGTCATTATCTGGTTTATCTCACA
TGAGAAAACACATATTCGTTTACTTAGTGCATTCCTGGTCGGAATAACCTGGCCAATGAGTCTGCCTGTGGCATTACTTT
TTTCTCTCTTTTAG
ATGGCACTATTCTCTAAAATATTAATTTTTTATGTGATTGGTGTGAACATATCCTTTGTCATTATCTGGTTTATCTCACA
TGAGAAAACACATATTCGTTTACTTAGTGCATTCCTGGTCGGAATAACCTGGCCAATGAGTCTGCCTGTGGCATTACTTT
TTTCTCTCTTTTAG
Antitoxin
Download Length: 66 bp
>AT239439 NZ_CP094273:c65118-65053 [Klebsiella aerogenes]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|