Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2480503..2480728 | Replicon | chromosome |
Accession | NZ_CP094269 | ||
Organism | Salmonella enterica subsp. enterica serovar Enteritidis strain JL228 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | MPK88_RS12180 | Protein ID | WP_000813254.1 |
Coordinates | 2480503..2480658 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2480670..2480728 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MPK88_RS12145 | 2475610..2475891 | - | 282 | WP_000445513.1 | phage holin family protein | - |
MPK88_RS12150 | 2475881..2476069 | - | 189 | WP_001688615.1 | putative holin | - |
MPK88_RS12155 | 2476063..2476386 | - | 324 | Protein_2379 | tellurite/colicin resistance protein | - |
MPK88_RS12160 | 2478557..2479093 | - | 537 | WP_000640113.1 | DUF1133 family protein | - |
MPK88_RS12165 | 2479090..2479380 | - | 291 | WP_000774470.1 | DUF1364 domain-containing protein | - |
MPK88_RS12170 | 2479380..2479979 | - | 600 | WP_000940751.1 | DUF1367 family protein | - |
MPK88_RS12175 | 2480042..2480212 | - | 171 | WP_000734094.1 | hypothetical protein | - |
MPK88_RS12180 | 2480503..2480658 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 2480670..2480728 | + | 59 | - | - | Antitoxin |
MPK88_RS12185 | 2481085..2481324 | + | 240 | WP_000556391.1 | hypothetical protein | - |
MPK88_RS12190 | 2481612..2482016 | + | 405 | WP_065314251.1 | hypothetical protein | - |
MPK88_RS12195 | 2482013..2482567 | + | 555 | WP_001033796.1 | hypothetical protein | - |
MPK88_RS12200 | 2482729..2483058 | - | 330 | WP_001676916.1 | DUF977 family protein | - |
MPK88_RS12205 | 2483102..2483149 | - | 48 | Protein_2389 | hypothetical protein | - |
MPK88_RS12210 | 2483331..2483798 | + | 468 | WP_001227859.1 | helix-turn-helix domain-containing protein | - |
MPK88_RS12215 | 2484183..2484338 | + | 156 | WP_085981757.1 | DUF1391 family protein | - |
MPK88_RS12220 | 2484446..2484967 | - | 522 | WP_000004762.1 | super-infection exclusion protein B | - |
MPK88_RS12225 | 2485405..2485626 | + | 222 | WP_000560208.1 | cell division protein FtsZ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2475068..2484967 | 9899 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T239400 WP_000813254.1 NZ_CP094269:c2480658-2480503 [Salmonella enterica subsp. enterica serovar Enteritidis]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T239400 NZ_LR890706:28345-28503 [Klebsiella pneumoniae]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 59 bp
>AT239400 NZ_CP094269:2480670-2480728 [Salmonella enterica subsp. enterica serovar Enteritidis]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|