23932

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1257308..1257528 Replicon chromosome
Accession NC_012892
Organism Escherichia coli BL21(DE3)

Toxin (Protein)


Gene name ldrD Uniprot ID E3PKK3
Locus tag B21_RS06355 Protein ID WP_000170951.1
Coordinates 1257308..1257415 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1257465..1257528 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
B21_RS06330 1253154..1254236 + 1083 WP_000804726.1 peptide chain release factor 1 -
B21_RS06335 1254236..1255069 + 834 WP_000456454.1 peptide chain release factor N(5)-glutamine methyltransferase -
B21_RS06340 1255066..1255458 + 393 WP_000200373.1 invasion regulator SirB2 -
B21_RS06345 1255462..1256271 + 810 WP_001257044.1 invasion regulator SirB1 -
B21_RS06350 1256307..1257161 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
B21_RS06355 1257308..1257415 - 108 WP_000170951.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1257465..1257528 + 64 NuclAT_32 - Antitoxin
- 1257465..1257528 + 64 NuclAT_32 - Antitoxin
- 1257465..1257528 + 64 NuclAT_32 - Antitoxin
- 1257465..1257528 + 64 NuclAT_32 - Antitoxin
- 1257465..1257528 + 64 NuclAT_35 - Antitoxin
- 1257465..1257528 + 64 NuclAT_35 - Antitoxin
- 1257465..1257528 + 64 NuclAT_35 - Antitoxin
- 1257465..1257528 + 64 NuclAT_35 - Antitoxin
- 1257465..1257528 + 64 NuclAT_38 - Antitoxin
- 1257465..1257528 + 64 NuclAT_38 - Antitoxin
- 1257465..1257528 + 64 NuclAT_38 - Antitoxin
- 1257465..1257528 + 64 NuclAT_38 - Antitoxin
- 1257465..1257528 + 64 NuclAT_41 - Antitoxin
- 1257465..1257528 + 64 NuclAT_41 - Antitoxin
- 1257465..1257528 + 64 NuclAT_41 - Antitoxin
- 1257465..1257528 + 64 NuclAT_41 - Antitoxin
- 1257465..1257528 + 64 NuclAT_47 - Antitoxin
- 1257465..1257528 + 64 NuclAT_47 - Antitoxin
- 1257465..1257528 + 64 NuclAT_47 - Antitoxin
- 1257465..1257528 + 64 NuclAT_47 - Antitoxin
- 1257465..1257528 + 64 NuclAT_50 - Antitoxin
- 1257465..1257528 + 64 NuclAT_50 - Antitoxin
- 1257465..1257528 + 64 NuclAT_50 - Antitoxin
- 1257465..1257528 + 64 NuclAT_50 - Antitoxin
B21_RS06360 1257843..1257950 - 108 WP_000170963.1 small toxic polypeptide LdrB -
- 1257998..1258063 + 66 NuclAT_30 - -
- 1257998..1258063 + 66 NuclAT_30 - -
- 1257998..1258063 + 66 NuclAT_30 - -
- 1257998..1258063 + 66 NuclAT_30 - -
- 1257998..1258063 + 66 NuclAT_33 - -
- 1257998..1258063 + 66 NuclAT_33 - -
- 1257998..1258063 + 66 NuclAT_33 - -
- 1257998..1258063 + 66 NuclAT_33 - -
- 1257998..1258063 + 66 NuclAT_36 - -
- 1257998..1258063 + 66 NuclAT_36 - -
- 1257998..1258063 + 66 NuclAT_36 - -
- 1257998..1258063 + 66 NuclAT_36 - -
- 1257998..1258063 + 66 NuclAT_39 - -
- 1257998..1258063 + 66 NuclAT_39 - -
- 1257998..1258063 + 66 NuclAT_39 - -
- 1257998..1258063 + 66 NuclAT_39 - -
- 1257998..1258063 + 66 NuclAT_45 - -
- 1257998..1258063 + 66 NuclAT_45 - -
- 1257998..1258063 + 66 NuclAT_45 - -
- 1257998..1258063 + 66 NuclAT_45 - -
- 1257998..1258063 + 66 NuclAT_48 - -
- 1257998..1258063 + 66 NuclAT_48 - -
- 1257998..1258063 + 66 NuclAT_48 - -
- 1257998..1258063 + 66 NuclAT_48 - -
- 1257998..1258065 + 68 NuclAT_16 - -
- 1257998..1258065 + 68 NuclAT_16 - -
- 1257998..1258065 + 68 NuclAT_16 - -
- 1257998..1258065 + 68 NuclAT_16 - -
- 1257998..1258065 + 68 NuclAT_18 - -
- 1257998..1258065 + 68 NuclAT_18 - -
- 1257998..1258065 + 68 NuclAT_18 - -
- 1257998..1258065 + 68 NuclAT_18 - -
- 1257998..1258065 + 68 NuclAT_20 - -
- 1257998..1258065 + 68 NuclAT_20 - -
- 1257998..1258065 + 68 NuclAT_20 - -
- 1257998..1258065 + 68 NuclAT_20 - -
- 1257998..1258065 + 68 NuclAT_22 - -
- 1257998..1258065 + 68 NuclAT_22 - -
- 1257998..1258065 + 68 NuclAT_22 - -
- 1257998..1258065 + 68 NuclAT_22 - -
- 1257998..1258065 + 68 NuclAT_24 - -
- 1257998..1258065 + 68 NuclAT_24 - -
- 1257998..1258065 + 68 NuclAT_24 - -
- 1257998..1258065 + 68 NuclAT_24 - -
- 1257998..1258065 + 68 NuclAT_26 - -
- 1257998..1258065 + 68 NuclAT_26 - -
- 1257998..1258065 + 68 NuclAT_26 - -
- 1257998..1258065 + 68 NuclAT_26 - -
B21_RS06365 1258378..1258485 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1258533..1258598 + 66 NuclAT_31 - -
- 1258533..1258598 + 66 NuclAT_31 - -
- 1258533..1258598 + 66 NuclAT_31 - -
- 1258533..1258598 + 66 NuclAT_31 - -
- 1258533..1258598 + 66 NuclAT_34 - -
- 1258533..1258598 + 66 NuclAT_34 - -
- 1258533..1258598 + 66 NuclAT_34 - -
- 1258533..1258598 + 66 NuclAT_34 - -
- 1258533..1258598 + 66 NuclAT_37 - -
- 1258533..1258598 + 66 NuclAT_37 - -
- 1258533..1258598 + 66 NuclAT_37 - -
- 1258533..1258598 + 66 NuclAT_37 - -
- 1258533..1258598 + 66 NuclAT_40 - -
- 1258533..1258598 + 66 NuclAT_40 - -
- 1258533..1258598 + 66 NuclAT_40 - -
- 1258533..1258598 + 66 NuclAT_40 - -
- 1258533..1258598 + 66 NuclAT_46 - -
- 1258533..1258598 + 66 NuclAT_46 - -
- 1258533..1258598 + 66 NuclAT_46 - -
- 1258533..1258598 + 66 NuclAT_46 - -
- 1258533..1258598 + 66 NuclAT_49 - -
- 1258533..1258598 + 66 NuclAT_49 - -
- 1258533..1258598 + 66 NuclAT_49 - -
- 1258533..1258598 + 66 NuclAT_49 - -
- 1258533..1258600 + 68 NuclAT_15 - -
- 1258533..1258600 + 68 NuclAT_15 - -
- 1258533..1258600 + 68 NuclAT_15 - -
- 1258533..1258600 + 68 NuclAT_15 - -
- 1258533..1258600 + 68 NuclAT_17 - -
- 1258533..1258600 + 68 NuclAT_17 - -
- 1258533..1258600 + 68 NuclAT_17 - -
- 1258533..1258600 + 68 NuclAT_17 - -
- 1258533..1258600 + 68 NuclAT_19 - -
- 1258533..1258600 + 68 NuclAT_19 - -
- 1258533..1258600 + 68 NuclAT_19 - -
- 1258533..1258600 + 68 NuclAT_19 - -
- 1258533..1258600 + 68 NuclAT_21 - -
- 1258533..1258600 + 68 NuclAT_21 - -
- 1258533..1258600 + 68 NuclAT_21 - -
- 1258533..1258600 + 68 NuclAT_21 - -
- 1258533..1258600 + 68 NuclAT_23 - -
- 1258533..1258600 + 68 NuclAT_23 - -
- 1258533..1258600 + 68 NuclAT_23 - -
- 1258533..1258600 + 68 NuclAT_23 - -
- 1258533..1258600 + 68 NuclAT_25 - -
- 1258533..1258600 + 68 NuclAT_25 - -
- 1258533..1258600 + 68 NuclAT_25 - -
- 1258533..1258600 + 68 NuclAT_25 - -
B21_RS06370 1258890..1259990 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
B21_RS06375 1260260..1260490 + 231 WP_001146444.1 putative cation transport regulator ChaB -
B21_RS06380 1260648..1261343 + 696 WP_012775986.1 glutathione-specific gamma-glutamylcyclotransferase -
B21_RS06385 1261387..1261740 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3961.74 Da        Isoelectric Point: 9.1413

>T23932 WP_000170951.1 NC_012892:c1257415-1257308 [Escherichia coli BL21(DE3)]
MTLAQFAMIFWDDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T23932 NC_012892:c1257415-1257308 [Escherichia coli BL21(DE3)]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGGACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 64 bp

>AT23932 NC_012892:1257465-1257528 [Escherichia coli BL21(DE3)]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGATTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB E3PKK3

Antitoxin

Download structure file

References