Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2523699..2523883 | Replicon | chromosome |
Accession | NZ_CP093933 | ||
Organism | Staphylococcus aureus strain WA121-2021_15363 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
Locus tag | MQP45_RS12775 | Protein ID | WP_000482652.1 |
Coordinates | 2523776..2523883 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2523699..2523759 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MQP45_RS12760 | 2519154..2519285 | - | 132 | WP_223197975.1 | hypothetical protein | - |
MQP45_RS12765 | 2519552..2521285 | - | 1734 | WP_000486487.1 | ABC transporter ATP-binding protein | - |
MQP45_RS12770 | 2521310..2523073 | - | 1764 | WP_001064825.1 | ABC transporter ATP-binding protein | - |
- | 2523699..2523759 | + | 61 | - | - | Antitoxin |
MQP45_RS12775 | 2523776..2523883 | - | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
MQP45_RS12780 | 2524017..2524403 | - | 387 | WP_000779360.1 | flippase GtxA | - |
MQP45_RS12785 | 2524671..2525813 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
MQP45_RS12790 | 2525873..2526532 | + | 660 | WP_000831298.1 | membrane protein | - |
MQP45_RS12795 | 2526714..2527925 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
MQP45_RS12800 | 2528048..2528521 | - | 474 | WP_000456486.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T239100 WP_000482652.1 NZ_CP093933:c2523883-2523776 [Staphylococcus aureus]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T239100 NZ_LR890603:2686707-2686814 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 61 bp
>AT239100 NZ_CP093933:2523699-2523759 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|