Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 86230..86484 | Replicon | plasmid pGA_EcoNDM5 |
| Accession | NZ_CP093920 | ||
| Organism | Escherichia coli strain ST167 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | MOO49_RS23800 | Protein ID | WP_001312851.1 |
| Coordinates | 86335..86484 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 86230..86291 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MOO49_RS23765 (81882) | 81882..82094 | + | 213 | WP_005012601.1 | hypothetical protein | - |
| MOO49_RS23770 (82395) | 82395..82484 | - | 90 | Protein_93 | IS1 family transposase | - |
| MOO49_RS23775 (82539) | 82539..83216 | + | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| MOO49_RS23780 (83216) | 83216..83563 | + | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| MOO49_RS23785 (83583) | 83583..85154 | + | 1572 | WP_023149734.1 | IS66-like element ISCro1 family transposase | - |
| MOO49_RS23790 (85192) | 85192..85808 | - | 617 | Protein_97 | IS1-like element IS1A family transposase | - |
| MOO49_RS23795 (85909) | 85909..86091 | + | 183 | WP_000968309.1 | hypothetical protein | - |
| - (86230) | 86230..86291 | - | 62 | NuclAT_0 | - | Antitoxin |
| - (86230) | 86230..86291 | - | 62 | NuclAT_0 | - | Antitoxin |
| - (86230) | 86230..86291 | - | 62 | NuclAT_0 | - | Antitoxin |
| - (86230) | 86230..86291 | - | 62 | NuclAT_0 | - | Antitoxin |
| MOO49_RS23800 (86335) | 86335..86484 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| MOO49_RS23805 (86768) | 86768..87025 | + | 258 | WP_000083833.1 | replication regulatory protein RepA | - |
| MOO49_RS23810 (87261) | 87261..87335 | + | 75 | WP_032336874.1 | RepA leader peptide Tap | - |
| MOO49_RS23815 (87328) | 87328..87774 | + | 447 | Protein_102 | plasmid replication initiator RepA | - |
| MOO49_RS23820 (87774) | 87774..88388 | - | 615 | Protein_103 | VENN motif pre-toxin domain-containing protein | - |
| MOO49_RS23825 (89095) | 89095..90315 | + | 1221 | WP_000410951.1 | arginine deiminase | - |
| MOO49_RS23830 (90326) | 90326..91237 | + | 912 | WP_000440183.1 | carbamate kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | tet(A) / dfrA12 / aadA2 / qacE / sul1 / blaNDM-5 / aac(3)-IIa / mph(A) / sitABCD | iucA / iucB / iucC / iucD / iutA | 1..100291 | 100291 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T239053 WP_001312851.1 NZ_CP093920:86335-86484 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T239053 NZ_LR890583:4005438-4005656 [Klebsiella pneumoniae]
ATGTCTGATAAGCCATTAACTAAAACAGACTATTTGATGCGCTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGCGT
CATTGAAAAAAATAAATATGAACTGTCTGATAATGAGCTGGCGGTATTTTACTCAGCTGCCGACCATCGTCTGGCGGAAC
TGACCATGAATAAGCTATACGATAAAATCCCGACTTCTGTCTGGAAATTTATCCGCTAA
ATGTCTGATAAGCCATTAACTAAAACAGACTATTTGATGCGCTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGCGT
CATTGAAAAAAATAAATATGAACTGTCTGATAATGAGCTGGCGGTATTTTACTCAGCTGCCGACCATCGTCTGGCGGAAC
TGACCATGAATAAGCTATACGATAAAATCCCGACTTCTGTCTGGAAATTTATCCGCTAA
Antitoxin
Download Length: 62 bp
>AT239053 NZ_CP093920:c86291-86230 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|