Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 382482..382703 Replicon chromosome
Accession NZ_CP093548
Organism Escherichia coli strain YL03

Toxin (Protein)


Gene name ldrD Uniprot ID A0A229AEQ8
Locus tag MPJ80_RS01975 Protein ID WP_000176713.1
Coordinates 382482..382589 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 382637..382703 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MPJ80_RS01945 (377616) 377616..378698 + 1083 WP_000804726.1 peptide chain release factor 1 -
MPJ80_RS01950 (378698) 378698..379531 + 834 WP_000456570.1 peptide chain release factor N(5)-glutamine methyltransferase -
MPJ80_RS01955 (379528) 379528..379920 + 393 WP_000200377.1 invasion regulator SirB2 -
MPJ80_RS01960 (379924) 379924..380733 + 810 WP_001257044.1 invasion regulator SirB1 -
MPJ80_RS01965 (380769) 380769..381623 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
MPJ80_RS01970 (381818) 381818..382276 + 459 WP_000526135.1 IS200/IS605-like element IS200C family transposase -
MPJ80_RS01975 (382482) 382482..382589 - 108 WP_000176713.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (382639) 382639..382702 + 64 NuclAT_46 - -
- (382639) 382639..382702 + 64 NuclAT_46 - -
- (382639) 382639..382702 + 64 NuclAT_46 - -
- (382639) 382639..382702 + 64 NuclAT_46 - -
- (382639) 382639..382702 + 64 NuclAT_48 - -
- (382639) 382639..382702 + 64 NuclAT_48 - -
- (382639) 382639..382702 + 64 NuclAT_48 - -
- (382639) 382639..382702 + 64 NuclAT_48 - -
- (382637) 382637..382703 + 67 NuclAT_21 - Antitoxin
- (382637) 382637..382703 + 67 NuclAT_21 - Antitoxin
- (382637) 382637..382703 + 67 NuclAT_21 - Antitoxin
- (382637) 382637..382703 + 67 NuclAT_21 - Antitoxin
- (382637) 382637..382703 + 67 NuclAT_26 - Antitoxin
- (382637) 382637..382703 + 67 NuclAT_26 - Antitoxin
- (382637) 382637..382703 + 67 NuclAT_26 - Antitoxin
- (382637) 382637..382703 + 67 NuclAT_26 - Antitoxin
- (382637) 382637..382703 + 67 NuclAT_31 - Antitoxin
- (382637) 382637..382703 + 67 NuclAT_31 - Antitoxin
- (382637) 382637..382703 + 67 NuclAT_31 - Antitoxin
- (382637) 382637..382703 + 67 NuclAT_31 - Antitoxin
- (382637) 382637..382703 + 67 NuclAT_36 - Antitoxin
- (382637) 382637..382703 + 67 NuclAT_36 - Antitoxin
- (382637) 382637..382703 + 67 NuclAT_36 - Antitoxin
- (382637) 382637..382703 + 67 NuclAT_36 - Antitoxin
- (382637) 382637..382703 + 67 NuclAT_38 - Antitoxin
- (382637) 382637..382703 + 67 NuclAT_38 - Antitoxin
- (382637) 382637..382703 + 67 NuclAT_38 - Antitoxin
- (382637) 382637..382703 + 67 NuclAT_38 - Antitoxin
- (382637) 382637..382703 + 67 NuclAT_43 - Antitoxin
- (382637) 382637..382703 + 67 NuclAT_43 - Antitoxin
- (382637) 382637..382703 + 67 NuclAT_43 - Antitoxin
- (382637) 382637..382703 + 67 NuclAT_43 - Antitoxin
MPJ80_RS01980 (383017) 383017..383124 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (383177) 383177..383238 + 62 NuclAT_45 - -
- (383177) 383177..383238 + 62 NuclAT_45 - -
- (383177) 383177..383238 + 62 NuclAT_45 - -
- (383177) 383177..383238 + 62 NuclAT_45 - -
- (383177) 383177..383238 + 62 NuclAT_47 - -
- (383177) 383177..383238 + 62 NuclAT_47 - -
- (383177) 383177..383238 + 62 NuclAT_47 - -
- (383177) 383177..383238 + 62 NuclAT_47 - -
- (383177) 383177..383239 + 63 NuclAT_22 - -
- (383177) 383177..383239 + 63 NuclAT_22 - -
- (383177) 383177..383239 + 63 NuclAT_22 - -
- (383177) 383177..383239 + 63 NuclAT_22 - -
- (383177) 383177..383239 + 63 NuclAT_27 - -
- (383177) 383177..383239 + 63 NuclAT_27 - -
- (383177) 383177..383239 + 63 NuclAT_27 - -
- (383177) 383177..383239 + 63 NuclAT_27 - -
- (383177) 383177..383239 + 63 NuclAT_32 - -
- (383177) 383177..383239 + 63 NuclAT_32 - -
- (383177) 383177..383239 + 63 NuclAT_32 - -
- (383177) 383177..383239 + 63 NuclAT_32 - -
- (383177) 383177..383239 + 63 NuclAT_37 - -
- (383177) 383177..383239 + 63 NuclAT_37 - -
- (383177) 383177..383239 + 63 NuclAT_37 - -
- (383177) 383177..383239 + 63 NuclAT_37 - -
- (383177) 383177..383239 + 63 NuclAT_39 - -
- (383177) 383177..383239 + 63 NuclAT_39 - -
- (383177) 383177..383239 + 63 NuclAT_39 - -
- (383177) 383177..383239 + 63 NuclAT_39 - -
- (383177) 383177..383239 + 63 NuclAT_44 - -
- (383177) 383177..383239 + 63 NuclAT_44 - -
- (383177) 383177..383239 + 63 NuclAT_44 - -
- (383177) 383177..383239 + 63 NuclAT_44 - -
MPJ80_RS01985 (383530) 383530..384630 - 1101 WP_001309461.1 sodium-potassium/proton antiporter ChaA -
MPJ80_RS01990 (384900) 384900..385130 + 231 WP_001146444.1 putative cation transport regulator ChaB -
MPJ80_RS01995 (385288) 385288..385983 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
MPJ80_RS02000 (386027) 386027..386380 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 381818..382276 458


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4031.79 Da        Isoelectric Point: 11.4779

>T238853 WP_000176713.1 NZ_CP093548:c382589-382482 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T238853 NZ_LR890508:c2468965-2468615 [Escherichia coli]
ATGGTAAAGAAAAGTGAATTTGAACGGGGAGACATTGTGCTGGTTGGCTTTGATCCAGCAAGCGGCCATGAACAGCAAGG
TGCTGGTCGACCTGCGCTTGTGCTCTCCGTTCAAGCCTTTAATCAACTGGGAATGACGCTGGTGGCCCCCATTACGCAGG
GCGGAAATTTTGCCCGTTATGCCGGATTTAGCGTTCCTTTACATTGCGAAGAAGGCGATGTGCACGGCGTGGTGCTGGTG
AATCAGGTGCGGATGATGGATCTACACGCCCGGCTGGCAAAGCGTATTGGTCTGGCTGCGGATGAGGTGGTGGAAGAGGC
GTTATTACGCTTGCAGGCGGTGGTGGAATAA

Antitoxin


Download         Length: 67 bp

>AT238853 NZ_CP093548:382637-382703 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A229AEQ8

Antitoxin

Download structure file

References