Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 20315..20476 | Replicon | plasmid unnamed2 |
Accession | NZ_CP093541 | ||
Organism | Staphylococcus hominis strain C5 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | MOV58_RS12290 | Protein ID | WP_002441941.1 |
Coordinates | 20315..20410 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 20439..20476 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MOV58_RS12260 (16067) | 16067..16246 | + | 180 | WP_145418343.1 | hypothetical protein | - |
MOV58_RS12265 (16372) | 16372..16563 | + | 192 | WP_002449162.1 | hypothetical protein | - |
MOV58_RS12270 (17394) | 17394..17960 | - | 567 | WP_242413996.1 | helix-turn-helix transcriptional regulator | - |
MOV58_RS12275 (18262) | 18262..18888 | - | 627 | WP_242413997.1 | type II CAAX endopeptidase family protein | - |
MOV58_RS12280 (19074) | 19074..19253 | + | 180 | Protein_22 | hypothetical protein | - |
MOV58_RS12285 (19357) | 19357..19968 | - | 612 | WP_242413998.1 | type II CAAX endopeptidase family protein | - |
MOV58_RS12290 (20315) | 20315..20410 | + | 96 | WP_002441941.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- (20439) | 20439..20476 | - | 38 | NuclAT_0 | - | Antitoxin |
- (20439) | 20439..20476 | - | 38 | NuclAT_0 | - | Antitoxin |
- (20439) | 20439..20476 | - | 38 | NuclAT_0 | - | Antitoxin |
MOV58_RS12295 (20589) | 20589..21362 | + | 774 | WP_242413999.1 | hypothetical protein | - |
MOV58_RS12300 (21397) | 21397..22398 | + | 1002 | WP_242414000.1 | nucleotidyltransferase | - |
MOV58_RS12305 (22558) | 22558..23166 | + | 609 | WP_242414001.1 | recombinase family protein | - |
MOV58_RS12310 (24391) | 24391..25164 | - | 774 | WP_077701580.1 | ABC transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3560.34 Da Isoelectric Point: 9.9256
>T238847 WP_002441941.1 NZ_CP093541:20315-20410 [Staphylococcus hominis]
MLMIFVHIIAPVISGCAVAYFTYWLSSKRNK
MLMIFVHIIAPVISGCAVAYFTYWLSSKRNK
Download Length: 96 bp
>T238847 NZ_LR890508:c762532-762356 [Escherichia coli]
GTGAAACAAAGCGAGTTCAGACGTTGGCTCGAATCTCAGGGCGTCGATGTAGCGAATGGCAGCAACCATTTGAAACTCAG
GTTTCATGGGAGGCGCAGTGTCATGCCGCGTCACCCCTGCGATGAGATTAAAGAACCATTGCGTAAAGCAATCCTGAAAC
AACTCGGTTTGAGTTAA
GTGAAACAAAGCGAGTTCAGACGTTGGCTCGAATCTCAGGGCGTCGATGTAGCGAATGGCAGCAACCATTTGAAACTCAG
GTTTCATGGGAGGCGCAGTGTCATGCCGCGTCACCCCTGCGATGAGATTAAAGAACCATTGCGTAAAGCAATCCTGAAAC
AACTCGGTTTGAGTTAA
Antitoxin
Download Length: 38 bp
>AT238847 NZ_CP093541:c20476-20439 [Staphylococcus hominis]
TATGCACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
TATGCACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|