Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 1157647..1157869 | Replicon | chromosome |
Accession | NC_012759 | ||
Organism | Escherichia coli BW2952 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | J7R083 |
Locus tag | BWG_RS05770 | Protein ID | WP_000170963.1 |
Coordinates | 1157647..1157754 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 1157802..1157869 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BWG_RS05740 (BWG_1036) | 1152956..1154038 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
BWG_RS05745 (BWG_1037) | 1154038..1154871 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
BWG_RS05750 (BWG_1038) | 1154868..1155260 | + | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
BWG_RS05755 (BWG_1039) | 1155264..1156073 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
BWG_RS05760 (BWG_1040) | 1156109..1156963 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
BWG_RS05765 (BWG_1041) | 1157112..1157219 | - | 108 | WP_000170955.1 | small toxic polypeptide LdrA/LdrC | - |
BWG_RS05770 (BWG_1042) | 1157647..1157754 | - | 108 | WP_000170963.1 | small toxic polypeptide LdrB | Toxin |
- | 1157802..1157869 | + | 68 | - | - | Antitoxin |
BWG_RS05775 (BWG_1043) | 1158182..1158289 | - | 108 | WP_000170955.1 | small toxic polypeptide LdrA/LdrC | - |
BWG_RS05780 (BWG_1044) | 1158693..1159793 | - | 1101 | WP_000063607.1 | sodium-potassium/proton antiporter ChaA | - |
BWG_RS05785 (BWG_1045) | 1160063..1160293 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
BWG_RS05790 (BWG_1046) | 1160451..1161146 | + | 696 | WP_001336325.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
BWG_RS05795 (BWG_1047) | 1161190..1161543 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3971.74 Da Isoelectric Point: 11.4779
>T23842 WP_000170963.1 NC_012759:c1157754-1157647 [Escherichia coli BW2952]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T23842 NC_012759:c1157754-1157647 [Escherichia coli BW2952]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 68 bp
>AT23842 NC_012759:1157802-1157869 [Escherichia coli BW2952]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|