Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 223639..223903 Replicon plasmid p423_13
Accession NZ_CP093374
Organism Salmonella enterica subsp. enterica serovar Infantis strain 423_13

Toxin (Protein)


Gene name pndA Uniprot ID U9Z417
Locus tag MNU28_RS24000 Protein ID WP_001387489.1
Coordinates 223639..223791 (-) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 223843..223903 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MNU28_RS23970 (218906) 218906..221074 + 2169 WP_058649949.1 DotA/TraY family protein -
MNU28_RS23975 (221145) 221145..221807 + 663 WP_000644796.1 plasmid IncI1-type surface exclusion protein ExcA -
MNU28_RS23980 (221879) 221879..222088 - 210 WP_000062603.1 HEAT repeat domain-containing protein -
MNU28_RS23985 (222480) 222480..222656 + 177 WP_001054897.1 hypothetical protein -
MNU28_RS23990 (222721) 222721..223017 - 297 WP_011264046.1 DinQ-like type I toxin DqlB -
MNU28_RS23995 (223316) 223316..223567 + 252 WP_001291964.1 hypothetical protein -
MNU28_RS24000 (223639) 223639..223791 - 153 WP_001387489.1 Hok/Gef family protein Toxin
- (223843) 223843..223903 + 61 NuclAT_0 - Antitoxin
- (223843) 223843..223903 + 61 NuclAT_0 - Antitoxin
- (223843) 223843..223903 + 61 NuclAT_0 - Antitoxin
- (223843) 223843..223903 + 61 NuclAT_0 - Antitoxin
MNU28_RS24005 (224112) 224112..225197 + 1086 WP_000080543.1 protein finQ -
MNU28_RS24010 (225504) 225504..226712 + 1209 WP_001383960.1 IncI1-type conjugal transfer protein TrbA -
MNU28_RS24015 (226731) 226731..227801 + 1071 WP_000151583.1 IncI1-type conjugal transfer protein TrbB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid ant(3'')-Ia / qacE / sul1 / tet(A) / blaCTX-M-65 / fosA3 / floR / aph(4)-Ia / aac(3)-IVa / dfrA14 faeC / faeD / faeD / faeE / faeF / faeH / faeI / fyuA / ybtE / ybtE / ybtT / ybtU / irp1 / irp2 / irp2 / ybtA / ybtP / ybtQ / ybtX / ybtS 1..320713 320713


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5761.10 Da        Isoelectric Point: 8.7948

>T238323 WP_001387489.1 NZ_CP093374:c223791-223639 [Salmonella enterica subsp. enterica serovar Infantis]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

>T238323 NZ_LR890307:1879900-1880002 [Klebsiella pneumoniae]
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT

Antitoxin


Download         Length: 61 bp

>AT238323 NZ_CP093374:223843-223903 [Salmonella enterica subsp. enterica serovar Infantis]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9Z417

Antitoxin

Download structure file

References