Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 116740..117391 | Replicon | plasmid pW18-2-a |
Accession | NZ_CP093250 | ||
Organism | Moellerella wisconsensis strain W18-2 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A1B8HBJ1 |
Locus tag | MNY64_RS16730 | Protein ID | WP_067423956.1 |
Coordinates | 117041..117391 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A1B8HBM2 |
Locus tag | MNY64_RS16725 | Protein ID | WP_067423953.1 |
Coordinates | 116740..117039 (-) | Length | 100 a.a. |
Genomic Context
Location: 113357..113566 (210 bp)
Type: Others
Protein ID: WP_109910748.1
Type: Others
Protein ID: WP_109910748.1
Location: 113643..113957 (315 bp)
Type: Others
Protein ID: WP_082981384.1
Type: Others
Protein ID: WP_082981384.1
Location: 113938..114174 (237 bp)
Type: Others
Protein ID: WP_067423943.1
Type: Others
Protein ID: WP_067423943.1
Location: 114231..114449 (219 bp)
Type: Others
Protein ID: WP_109910747.1
Type: Others
Protein ID: WP_109910747.1
Location: 114483..115007 (525 bp)
Type: Others
Protein ID: WP_067423945.1
Type: Others
Protein ID: WP_067423945.1
Location: 115439..115840 (402 bp)
Type: Others
Protein ID: WP_067423949.1
Type: Others
Protein ID: WP_067423949.1
Location: 117587..118147 (561 bp)
Type: Others
Protein ID: WP_213914584.1
Type: Others
Protein ID: WP_213914584.1
Location: 118689..119591 (903 bp)
Type: Others
Protein ID: WP_241502041.1
Type: Others
Protein ID: WP_241502041.1
Location: 119601..120200 (600 bp)
Type: Others
Protein ID: WP_241543888.1
Type: Others
Protein ID: WP_241543888.1
Location: 120197..120796 (600 bp)
Type: Others
Protein ID: WP_241542955.1
Type: Others
Protein ID: WP_241542955.1
Location: 112040..112340 (301 bp)
Type: Others
Protein ID: Protein_140
Type: Others
Protein ID: Protein_140
Location: 112377..112577 (201 bp)
Type: Others
Protein ID: Protein_141
Type: Others
Protein ID: Protein_141
Location: 112592..113140 (549 bp)
Type: Others
Protein ID: WP_082981383.1
Type: Others
Protein ID: WP_082981383.1
Location: 114961..115338 (378 bp)
Type: Others
Protein ID: WP_109910745.1
Type: Others
Protein ID: WP_109910745.1
Location: 115875..116711 (837 bp)
Type: Others
Protein ID: WP_109910744.1
Type: Others
Protein ID: WP_109910744.1
Location: 116740..117039 (300 bp)
Type: Antitoxin
Protein ID: WP_067423953.1
Type: Antitoxin
Protein ID: WP_067423953.1
Location: 117041..117391 (351 bp)
Type: Toxin
Protein ID: WP_067423956.1
Type: Toxin
Protein ID: WP_067423956.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MNY64_RS16670 (MNY64_16680) | 112040..112340 | - | 301 | Protein_140 | transposase | - |
MNY64_RS16675 (MNY64_16685) | 112377..112577 | - | 201 | Protein_141 | PAAR domain-containing protein | - |
MNY64_RS16680 (MNY64_16690) | 112592..113140 | - | 549 | WP_082981383.1 | PAAR domain-containing protein | - |
MNY64_RS16685 (MNY64_16695) | 113357..113566 | + | 210 | WP_109910748.1 | hypothetical protein | - |
MNY64_RS16690 (MNY64_16700) | 113643..113957 | + | 315 | WP_082981384.1 | hypothetical protein | - |
MNY64_RS16695 | 113938..114174 | + | 237 | WP_067423943.1 | hypothetical protein | - |
MNY64_RS16700 (MNY64_16705) | 114231..114449 | + | 219 | WP_109910747.1 | hypothetical protein | - |
MNY64_RS16705 (MNY64_16710) | 114483..115007 | + | 525 | WP_067423945.1 | hypothetical protein | - |
MNY64_RS16710 | 114961..115338 | - | 378 | WP_109910745.1 | hypothetical protein | - |
MNY64_RS16715 (MNY64_16720) | 115439..115840 | + | 402 | WP_067423949.1 | hypothetical protein | - |
MNY64_RS16720 (MNY64_16725) | 115875..116711 | - | 837 | WP_109910744.1 | hypothetical protein | - |
MNY64_RS16725 (MNY64_16730) | 116740..117039 | - | 300 | WP_067423953.1 | helix-turn-helix domain-containing protein | Antitoxin |
MNY64_RS16730 (MNY64_16735) | 117041..117391 | - | 351 | WP_067423956.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
MNY64_RS16735 (MNY64_16740) | 117587..118147 | + | 561 | WP_213914584.1 | recombinase family protein | - |
MNY64_RS16740 (MNY64_16745) | 118689..119591 | + | 903 | WP_241502041.1 | WYL domain-containing protein | - |
MNY64_RS16745 (MNY64_16750) | 119601..120200 | + | 600 | WP_241543888.1 | DUF1819 family protein | - |
MNY64_RS16750 (MNY64_16755) | 120197..120796 | + | 600 | WP_241542955.1 | DUF1788 domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | ant(3'')-Ia / lnu(F) / floR / aph(6)-Id / aph(3'')-Ib / sul2 / blaCTX-M-1 / mph(A) | - | 1..270793 | 270793 | |
- | flank | IS/Tn | - | - | 117587..118147 | 560 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13453.50 Da Isoelectric Point: 5.2661
>T237942 WP_067423956.1 NZ_CP093250:c117391-117041 [Moellerella wisconsensis]
MWEILTRDLFDSWFEEQNEETQIEVLAVLMILREDGPNLGRPQVDTLKGSQFPNMKELRIQVGGHPIRACFAFDPIRRGI
VLCAGDKKGKDETRFYKKLIKMADAEYSAHLLEQEK
MWEILTRDLFDSWFEEQNEETQIEVLAVLMILREDGPNLGRPQVDTLKGSQFPNMKELRIQVGGHPIRACFAFDPIRRGI
VLCAGDKKGKDETRFYKKLIKMADAEYSAHLLEQEK
Download Length: 351 bp
>T237942 NZ_LR883012:2099537-2099640 [Escherichia coli]
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
Antitoxin
Download Length: 100 a.a. Molecular weight: 10888.61 Da Isoelectric Point: 8.5841
>AT237942 WP_067423953.1 NZ_CP093250:c117039-116740 [Moellerella wisconsensis]
MSTLNELLAKQSPEALAKIEARAEEIRREITLAKIREELNLSQSELAKSLGVSQPSIAKLENVDNDPKLSTLKRYIKALG
GELSIDVTLPNGKRIGLHL
MSTLNELLAKQSPEALAKIEARAEEIRREITLAKIREELNLSQSELAKSLGVSQPSIAKLENVDNDPKLSTLKRYIKALG
GELSIDVTLPNGKRIGLHL
Download Length: 300 bp
>AT237942 NZ_LR883012:c2099678-2099407 [Escherichia coli]
AAAGTCAGCGAAGGAAATGCTTCTGGCTTTTAACAGATAAAAAGAGACCGAACACGATTCCTGTATTCGGTCCAGGGAAA
TGGCTCTTGGGAGAGAGCCGTGCGCTAAAAGTTGGCATTAATGCAGGCTTAGTTGCCTTGCCCTTTAAGAATAGATGACG
ACGCCAGGTTTTCCAGTTTGCGTGCAAAATGGTCAATAAAAAGCGCGGTGGTCATCAGCTTAAATGTTAAAAACCGCCCG
TTCTGGTGAAAGAACTGAGGCGGTTTTTTTAT
AAAGTCAGCGAAGGAAATGCTTCTGGCTTTTAACAGATAAAAAGAGACCGAACACGATTCCTGTATTCGGTCCAGGGAAA
TGGCTCTTGGGAGAGAGCCGTGCGCTAAAAGTTGGCATTAATGCAGGCTTAGTTGCCTTGCCCTTTAAGAATAGATGACG
ACGCCAGGTTTTCCAGTTTGCGTGCAAAATGGTCAATAAAAAGCGCGGTGGTCATCAGCTTAAATGTTAAAAACCGCCCG
TTCTGGTGAAAGAACTGAGGCGGTTTTTTTAT
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1B8HBJ1 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1B8HBM2 |