Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 99593..100317 | Replicon | plasmid pW51-a |
Accession | NZ_CP093246 | ||
Organism | Moellerella wisconsensis strain W51 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A4D7JCU9 |
Locus tag | MNY72_RS16460 | Protein ID | WP_067423691.1 |
Coordinates | 99593..99904 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A4D7J260 |
Locus tag | MNY72_RS16465 | Protein ID | WP_067423690.1 |
Coordinates | 99901..100317 (+) | Length | 139 a.a. |
Genomic Context
Location: 99593..99904 (312 bp)
Type: Toxin
Protein ID: WP_067423691.1
Type: Toxin
Protein ID: WP_067423691.1
Location: 99901..100317 (417 bp)
Type: Antitoxin
Protein ID: WP_067423690.1
Type: Antitoxin
Protein ID: WP_067423690.1
Location: 94744..95226 (483 bp)
Type: Others
Protein ID: WP_137022584.1
Type: Others
Protein ID: WP_137022584.1
Location: 95397..95846 (450 bp)
Type: Others
Protein ID: WP_137022583.1
Type: Others
Protein ID: WP_137022583.1
Location: 95910..96395 (486 bp)
Type: Others
Protein ID: WP_067423698.1
Type: Others
Protein ID: WP_067423698.1
Location: 96936..97808 (873 bp)
Type: Others
Protein ID: WP_235845366.1
Type: Others
Protein ID: WP_235845366.1
Location: 98114..98419 (306 bp)
Type: Others
Protein ID: WP_067423696.1
Type: Others
Protein ID: WP_067423696.1
Location: 98416..98733 (318 bp)
Type: Others
Protein ID: WP_067423694.1
Type: Others
Protein ID: WP_067423694.1
Location: 98856..99422 (567 bp)
Type: Others
Protein ID: WP_067423693.1
Type: Others
Protein ID: WP_067423693.1
Location: 100376..100681 (306 bp)
Type: Others
Protein ID: WP_137022580.1
Type: Others
Protein ID: WP_137022580.1
Location: 100707..101042 (336 bp)
Type: Others
Protein ID: WP_137022579.1
Type: Others
Protein ID: WP_137022579.1
Location: 101174..101950 (777 bp)
Type: Others
Protein ID: WP_067421877.1
Type: Others
Protein ID: WP_067421877.1
Location: 102014..102439 (426 bp)
Type: Others
Protein ID: WP_067421875.1
Type: Others
Protein ID: WP_067421875.1
Location: 102498..102995 (498 bp)
Type: Others
Protein ID: WP_137022577.1
Type: Others
Protein ID: WP_137022577.1
Location: 103332..103901 (570 bp)
Type: Others
Protein ID: WP_241502031.1
Type: Others
Protein ID: WP_241502031.1
Location: 104040..104597 (558 bp)
Type: Others
Protein ID: WP_137022574.1
Type: Others
Protein ID: WP_137022574.1
Location: 104766..105188 (423 bp)
Type: Others
Protein ID: WP_137022573.1
Type: Others
Protein ID: WP_137022573.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MNY72_RS16425 (MNY72_16420) | 94744..95226 | - | 483 | WP_137022584.1 | hypothetical protein | - |
MNY72_RS16430 (MNY72_16425) | 95397..95846 | - | 450 | WP_137022583.1 | hypothetical protein | - |
MNY72_RS16435 (MNY72_16430) | 95910..96395 | - | 486 | WP_067423698.1 | hypothetical protein | - |
MNY72_RS16440 (MNY72_16435) | 96936..97808 | - | 873 | WP_235845366.1 | repA protein | - |
MNY72_RS16445 (MNY72_16440) | 98114..98419 | - | 306 | WP_067423696.1 | hypothetical protein | - |
MNY72_RS16450 (MNY72_16445) | 98416..98733 | - | 318 | WP_067423694.1 | hypothetical protein | - |
MNY72_RS16455 (MNY72_16450) | 98856..99422 | - | 567 | WP_067423693.1 | hypothetical protein | - |
MNY72_RS16460 (MNY72_16455) | 99593..99904 | + | 312 | WP_067423691.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
MNY72_RS16465 (MNY72_16460) | 99901..100317 | + | 417 | WP_067423690.1 | helix-turn-helix domain-containing protein | Antitoxin |
MNY72_RS16470 (MNY72_16465) | 100376..100681 | - | 306 | WP_137022580.1 | hypothetical protein | - |
MNY72_RS16475 (MNY72_16470) | 100707..101042 | - | 336 | WP_137022579.1 | hypothetical protein | - |
MNY72_RS16480 (MNY72_16475) | 101174..101950 | - | 777 | WP_067421877.1 | methyltransferase | - |
MNY72_RS16485 (MNY72_16480) | 102014..102439 | - | 426 | WP_067421875.1 | hypothetical protein | - |
MNY72_RS16490 (MNY72_16485) | 102498..102995 | - | 498 | WP_137022577.1 | hypothetical protein | - |
MNY72_RS16495 (MNY72_16490) | 103332..103901 | - | 570 | WP_241502031.1 | GDSL-type esterase/lipase family protein | - |
MNY72_RS16500 (MNY72_16495) | 104040..104597 | - | 558 | WP_137022574.1 | hypothetical protein | - |
MNY72_RS16505 (MNY72_16500) | 104766..105188 | - | 423 | WP_137022573.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | aac(3)-IIa / aph(3')-Ia / mph(A) / blaCTX-M-1 / sul2 / aph(3'')-Ib / aph(6)-Id / dfrA1 / ant(3'')-Ia / tet(D) | - | 1..270632 | 270632 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12375.16 Da Isoelectric Point: 10.3654
>T237934 WP_067423691.1 NZ_CP093246:99593-99904 [Moellerella wisconsensis]
MHVISRDPFNQASKRFPNSAQALSDVYRTLKRDSYQTPDELKKVFPSLDRMKYREKWWVIDISGNALRMMFFADFDRGKI
FVKHITTHAEYDKLTDHYRRTKA
MHVISRDPFNQASKRFPNSAQALSDVYRTLKRDSYQTPDELKKVFPSLDRMKYREKWWVIDISGNALRMMFFADFDRGKI
FVKHITTHAEYDKLTDHYRRTKA
Download Length: 312 bp
>T237934 NZ_LR883012:180405-180512 [Escherichia coli]
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 139 a.a. Molecular weight: 15451.44 Da Isoelectric Point: 4.6155
>AT237934 WP_067423690.1 NZ_CP093246:99901-100317 [Moellerella wisconsensis]
MMFQDAVKAAQNLVNLVPLLGDSHSRPDYEKAVQLVEHLVENDPDNPLIDMICAKIDAYENAAPEFAEFNQRLAESNDGV
AALRTLMDQYNLNTTDFGNELGSRSYVSRILNGERGLTLEHIKNLSKRFGIPASIFIR
MMFQDAVKAAQNLVNLVPLLGDSHSRPDYEKAVQLVEHLVENDPDNPLIDMICAKIDAYENAAPEFAEFNQRLAESNDGV
AALRTLMDQYNLNTTDFGNELGSRSYVSRILNGERGLTLEHIKNLSKRFGIPASIFIR
Download Length: 417 bp
>AT237934 NZ_LR883012:c180357-180291 [Escherichia coli]
GGTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GGTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4D7JCU9 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4D7J260 |