Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2789511..2789708 | Replicon | chromosome |
| Accession | NZ_CP093239 | ||
| Organism | Escherichia marmotae strain W49-2 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | - |
| Locus tag | MNY74_RS13465 | Protein ID | WP_201797678.1 |
| Coordinates | 2789511..2789666 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2789678..2789708 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MNY74_RS13455 | 2786030..2787097 | - | 1068 | WP_236942588.1 | restriction endonuclease subunit S | - |
| MNY74_RS13460 | 2787166..2789349 | - | 2184 | WP_241556616.1 | N-6 DNA methylase | - |
| MNY74_RS13465 | 2789511..2789666 | - | 156 | WP_201797678.1 | Hok/Gef family protein | Toxin |
| - | 2789678..2789708 | + | 31 | - | - | Antitoxin |
| MNY74_RS13470 | 2789871..2790281 | - | 411 | WP_241556617.1 | antiterminator Q family protein | - |
| MNY74_RS13475 | 2790281..2790538 | - | 258 | WP_001064805.1 | hypothetical protein | - |
| MNY74_RS13480 | 2790535..2791926 | - | 1392 | WP_241556618.1 | replicative DNA helicase | - |
| MNY74_RS13485 | 2791923..2792801 | - | 879 | WP_241556619.1 | ATP-binding protein | - |
| MNY74_RS13490 | 2792812..2793636 | - | 825 | WP_241556621.1 | helix-turn-helix domain-containing protein | - |
| MNY74_RS13495 | 2793633..2793857 | - | 225 | WP_105282055.1 | hypothetical protein | - |
| MNY74_RS13500 | 2794045..2794707 | - | 663 | WP_241556623.1 | ash family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2743630..2802680 | 59050 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5828.08 Da Isoelectric Point: 7.7951
>T237913 WP_201797678.1 NZ_CP093239:c2789666-2789511 [Escherichia marmotae]
MKQQKAMLIALIVICLTVIAMALVMRKDLCEVRIRTGQTEVAVFVDYESRE
MKQQKAMLIALIVICLTVIAMALVMRKDLCEVRIRTGQTEVAVFVDYESRE
Download Length: 156 bp
>T237913 NZ_LR883006:2071306-2071409 [Escherichia coli]
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
Antitoxin
Download Length: 31 bp
>AT237913 NZ_CP093239:2789678-2789708 [Escherichia marmotae]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCT
CCTTGCCTTTCGGCACGTAAGAGGCTAACCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|