Detailed information of TA system TA237883

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 123137..123406
• Replicon: plasmid pEC-16-35-2
• Accession: NZ_CP093227
• Organism: Escherichia coli strain EC-16-35

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: MNY24_RS23810
• Protein ID: WP_001372321.1
• Coordinates: 123281..123406 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	123137..123202 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
MNY24_RS23775	118847..119374	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
MNY24_RS23780	119432..119665	+	234	WP_000006003.1	DUF905 family protein	-
MNY24_RS23785	119726..121749	+	2024	Protein_140	ParB/RepB/Spo0J family partition protein	-
MNY24_RS23790	121818..122252	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
MNY24_RS23795	122249..123011	+	763	Protein_142	plasmid SOS inhibition protein A	-
-	122980..123204	+	225	NuclAT_0	-	-
-	122980..123204	+	225	NuclAT_0	-	-
-	122980..123204	+	225	NuclAT_0	-	-
-	122980..123204	+	225	NuclAT_0	-	-
MNY24_RS23800	122989..123168	-	180	WP_001309233.1	hypothetical protein	-
-	123137..123202	-	66	-	-	Antitoxin
MNY24_RS23805	123190..123339	+	150	Protein_144	plasmid maintenance protein Mok	-
MNY24_RS23810	123281..123406	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
MNY24_RS23815	123725..124021	-	297	Protein_146	hypothetical protein	-
MNY24_RS23820	124321..124617	+	297	WP_001272251.1	hypothetical protein	-
MNY24_RS23825	124728..125549	+	822	WP_001234445.1	DUF932 domain-containing protein	-
MNY24_RS23830	125846..126493	-	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
MNY24_RS23835	126770..127153	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
MNY24_RS23840	127344..128030	+	687	WP_015059009.1	PAS domain-containing protein	-
MNY24_RS23845	128124..128351	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	tet(A) / dfrA17 / aadA5 / qacE / sul1 / mph(A) / floR / aph(6)-Id / aph(3'')-Ib / sul2 / erm(B) / blaTEM-1B / rmtB / fosA3 / blaCTX-M-55	-	1..212822	212822

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T237883 WP_001372321.1 NZ_CP093227:123281-123406 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

>T237883 NZ_LR882997:2215429-2215532 [Escherichia coli]
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT

Antitoxin

Nucleotide

• Length: 66 bp

>AT237883 NZ_CP093227:c123202-123137 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin