Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2909876..2910096 Replicon chromosome
Accession NZ_CP093068
Organism Escherichia coli strain BR1220

Toxin (Protein)


Gene name ldrD Uniprot ID A0A376PC51
Locus tag MM431_RS14280 Protein ID WP_072127060.1
Coordinates 2909989..2910096 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2909876..2909942 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MM431_RS14255 2905154..2906548 - 1395 WP_001400233.1 inverse autotransporter invasin YchO -
MM431_RS14260 2906734..2907087 + 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
MM431_RS14265 2907131..2907826 - 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
MM431_RS14270 2907984..2908214 - 231 WP_001146444.1 putative cation transport regulator ChaB -
MM431_RS14275 2908484..2909584 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 2909876..2909942 - 67 - - Antitoxin
MM431_RS14280 2909989..2910096 + 108 WP_072127060.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2910409..2910476 - 68 NuclAT_34 - -
- 2910409..2910476 - 68 NuclAT_34 - -
- 2910409..2910476 - 68 NuclAT_34 - -
- 2910409..2910476 - 68 NuclAT_34 - -
- 2910409..2910476 - 68 NuclAT_37 - -
- 2910409..2910476 - 68 NuclAT_37 - -
- 2910409..2910476 - 68 NuclAT_37 - -
- 2910409..2910476 - 68 NuclAT_37 - -
- 2910409..2910476 - 68 NuclAT_40 - -
- 2910409..2910476 - 68 NuclAT_40 - -
- 2910409..2910476 - 68 NuclAT_40 - -
- 2910409..2910476 - 68 NuclAT_40 - -
- 2910409..2910476 - 68 NuclAT_43 - -
- 2910409..2910476 - 68 NuclAT_43 - -
- 2910409..2910476 - 68 NuclAT_43 - -
- 2910409..2910476 - 68 NuclAT_43 - -
- 2910409..2910476 - 68 NuclAT_46 - -
- 2910409..2910476 - 68 NuclAT_46 - -
- 2910409..2910476 - 68 NuclAT_46 - -
- 2910409..2910476 - 68 NuclAT_46 - -
- 2910409..2910476 - 68 NuclAT_49 - -
- 2910409..2910476 - 68 NuclAT_49 - -
- 2910409..2910476 - 68 NuclAT_49 - -
- 2910409..2910476 - 68 NuclAT_49 - -
- 2910411..2910476 - 66 NuclAT_15 - -
- 2910411..2910476 - 66 NuclAT_15 - -
- 2910411..2910476 - 66 NuclAT_15 - -
- 2910411..2910476 - 66 NuclAT_15 - -
- 2910411..2910476 - 66 NuclAT_18 - -
- 2910411..2910476 - 66 NuclAT_18 - -
- 2910411..2910476 - 66 NuclAT_18 - -
- 2910411..2910476 - 66 NuclAT_18 - -
- 2910411..2910476 - 66 NuclAT_21 - -
- 2910411..2910476 - 66 NuclAT_21 - -
- 2910411..2910476 - 66 NuclAT_21 - -
- 2910411..2910476 - 66 NuclAT_21 - -
- 2910411..2910476 - 66 NuclAT_24 - -
- 2910411..2910476 - 66 NuclAT_24 - -
- 2910411..2910476 - 66 NuclAT_24 - -
- 2910411..2910476 - 66 NuclAT_24 - -
- 2910411..2910476 - 66 NuclAT_28 - -
- 2910411..2910476 - 66 NuclAT_28 - -
- 2910411..2910476 - 66 NuclAT_28 - -
- 2910411..2910476 - 66 NuclAT_28 - -
- 2910411..2910476 - 66 NuclAT_31 - -
- 2910411..2910476 - 66 NuclAT_31 - -
- 2910411..2910476 - 66 NuclAT_31 - -
- 2910411..2910476 - 66 NuclAT_31 - -
MM431_RS14285 2910524..2910631 + 108 WP_072127060.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2910944..2911009 - 66 NuclAT_36 - -
- 2910944..2911009 - 66 NuclAT_36 - -
- 2910944..2911009 - 66 NuclAT_36 - -
- 2910944..2911009 - 66 NuclAT_36 - -
- 2910944..2911009 - 66 NuclAT_39 - -
- 2910944..2911009 - 66 NuclAT_39 - -
- 2910944..2911009 - 66 NuclAT_39 - -
- 2910944..2911009 - 66 NuclAT_39 - -
- 2910944..2911009 - 66 NuclAT_42 - -
- 2910944..2911009 - 66 NuclAT_42 - -
- 2910944..2911009 - 66 NuclAT_42 - -
- 2910944..2911009 - 66 NuclAT_42 - -
- 2910944..2911009 - 66 NuclAT_45 - -
- 2910944..2911009 - 66 NuclAT_45 - -
- 2910944..2911009 - 66 NuclAT_45 - -
- 2910944..2911009 - 66 NuclAT_45 - -
- 2910944..2911009 - 66 NuclAT_48 - -
- 2910944..2911009 - 66 NuclAT_48 - -
- 2910944..2911009 - 66 NuclAT_48 - -
- 2910944..2911009 - 66 NuclAT_48 - -
- 2910944..2911009 - 66 NuclAT_51 - -
- 2910944..2911009 - 66 NuclAT_51 - -
- 2910944..2911009 - 66 NuclAT_51 - -
- 2910944..2911009 - 66 NuclAT_51 - -
- 2910946..2911009 - 64 NuclAT_17 - -
- 2910946..2911009 - 64 NuclAT_17 - -
- 2910946..2911009 - 64 NuclAT_17 - -
- 2910946..2911009 - 64 NuclAT_17 - -
- 2910946..2911009 - 64 NuclAT_20 - -
- 2910946..2911009 - 64 NuclAT_20 - -
- 2910946..2911009 - 64 NuclAT_20 - -
- 2910946..2911009 - 64 NuclAT_20 - -
- 2910946..2911009 - 64 NuclAT_23 - -
- 2910946..2911009 - 64 NuclAT_23 - -
- 2910946..2911009 - 64 NuclAT_23 - -
- 2910946..2911009 - 64 NuclAT_23 - -
- 2910946..2911009 - 64 NuclAT_26 - -
- 2910946..2911009 - 64 NuclAT_26 - -
- 2910946..2911009 - 64 NuclAT_26 - -
- 2910946..2911009 - 64 NuclAT_26 - -
- 2910946..2911009 - 64 NuclAT_30 - -
- 2910946..2911009 - 64 NuclAT_30 - -
- 2910946..2911009 - 64 NuclAT_30 - -
- 2910946..2911009 - 64 NuclAT_30 - -
- 2910946..2911009 - 64 NuclAT_33 - -
- 2910946..2911009 - 64 NuclAT_33 - -
- 2910946..2911009 - 64 NuclAT_33 - -
- 2910946..2911009 - 64 NuclAT_33 - -
MM431_RS14290 2911059..2911163 + 105 Protein_2813 type I toxin-antitoxin system toxin Ldr family protein -
MM431_RS14295 2911315..2912169 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
MM431_RS14300 2912205..2913014 - 810 WP_001257044.1 invasion regulator SirB1 -
MM431_RS14305 2913018..2913410 - 393 WP_000200378.1 invasion regulator SirB2 -
MM431_RS14310 2913407..2914240 - 834 WP_000456454.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3898.69 Da        Isoelectric Point: 11.4779

>T237677 WP_072127060.1 NZ_CP093068:2909989-2910096 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGLWRNRK

Download         Length: 108 bp

>T237677 NZ_LR882499:c1581493-1581092 [Mycobacterium tuberculosis variant microti OV254]
ATGATCCTTGTCGACTCCGATGTGCTGATCGCGCATTTGCGGGGTGTCGTTGCTGCTCGCGATTGGCTTGTCAGCGCCCG
CAAGGACGGACCGCTGGCGATCAGCGTGGTGTCCACCGCCGAACTCATCGGCGGAATGCGGACCGCCGAACGGCGCGAGG
TGTGGCGCCTGCTTGCATCGTTTCGGGTACAGCCAGCAACCGAGGTAATCGCACGCCGCGCCGGCGACATGATGCGCCGA
TATCGTCGCAGCCACAACCGGATTGGACTTGGCGACTATCTGATAGCTGCTACCGCCGACGTCCAGGGCCTGCAATTGGC
AACCCTCAACGTGTGGCATTTCCCCATGTTCGAGCAGCTGAAACCACCATTTGCGGTGCCGGGGCACCGACCGCGGGCAT
GA

Antitoxin


Download         Length: 67 bp

>AT237677 NZ_CP093068:c2909942-2909876 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A376PC51

Antitoxin

Download structure file

References