Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1269703..1269925 Replicon chromosome
Accession NZ_CP092702
Organism Escherichia coli strain S-P-C-029.01

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag MJ592_RS06245 Protein ID WP_000170963.1
Coordinates 1269703..1269810 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1269858..1269925 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MJ592_RS06215 (1265012) 1265012..1266094 + 1083 WP_000804726.1 peptide chain release factor 1 -
MJ592_RS06220 (1266094) 1266094..1266927 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
MJ592_RS06225 (1266924) 1266924..1267316 + 393 WP_000200374.1 invasion regulator SirB2 -
MJ592_RS06230 (1267320) 1267320..1268129 + 810 WP_001257044.1 invasion regulator SirB1 -
MJ592_RS06235 (1268165) 1268165..1269019 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
MJ592_RS06240 (1269168) 1269168..1269275 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1269323) 1269323..1269389 + 67 NuclAT_34 - -
- (1269323) 1269323..1269389 + 67 NuclAT_34 - -
- (1269323) 1269323..1269389 + 67 NuclAT_34 - -
- (1269323) 1269323..1269389 + 67 NuclAT_34 - -
- (1269323) 1269323..1269389 + 67 NuclAT_36 - -
- (1269323) 1269323..1269389 + 67 NuclAT_36 - -
- (1269323) 1269323..1269389 + 67 NuclAT_36 - -
- (1269323) 1269323..1269389 + 67 NuclAT_36 - -
- (1269323) 1269323..1269389 + 67 NuclAT_38 - -
- (1269323) 1269323..1269389 + 67 NuclAT_38 - -
- (1269323) 1269323..1269389 + 67 NuclAT_38 - -
- (1269323) 1269323..1269389 + 67 NuclAT_38 - -
- (1269323) 1269323..1269389 + 67 NuclAT_40 - -
- (1269323) 1269323..1269389 + 67 NuclAT_40 - -
- (1269323) 1269323..1269389 + 67 NuclAT_40 - -
- (1269323) 1269323..1269389 + 67 NuclAT_40 - -
- (1269323) 1269323..1269389 + 67 NuclAT_42 - -
- (1269323) 1269323..1269389 + 67 NuclAT_42 - -
- (1269323) 1269323..1269389 + 67 NuclAT_42 - -
- (1269323) 1269323..1269389 + 67 NuclAT_42 - -
- (1269323) 1269323..1269389 + 67 NuclAT_44 - -
- (1269323) 1269323..1269389 + 67 NuclAT_44 - -
- (1269323) 1269323..1269389 + 67 NuclAT_44 - -
- (1269323) 1269323..1269389 + 67 NuclAT_44 - -
- (1269325) 1269325..1269390 + 66 NuclAT_18 - -
- (1269325) 1269325..1269390 + 66 NuclAT_18 - -
- (1269325) 1269325..1269390 + 66 NuclAT_18 - -
- (1269325) 1269325..1269390 + 66 NuclAT_18 - -
- (1269325) 1269325..1269390 + 66 NuclAT_21 - -
- (1269325) 1269325..1269390 + 66 NuclAT_21 - -
- (1269325) 1269325..1269390 + 66 NuclAT_21 - -
- (1269325) 1269325..1269390 + 66 NuclAT_21 - -
- (1269325) 1269325..1269390 + 66 NuclAT_24 - -
- (1269325) 1269325..1269390 + 66 NuclAT_24 - -
- (1269325) 1269325..1269390 + 66 NuclAT_24 - -
- (1269325) 1269325..1269390 + 66 NuclAT_24 - -
- (1269325) 1269325..1269390 + 66 NuclAT_27 - -
- (1269325) 1269325..1269390 + 66 NuclAT_27 - -
- (1269325) 1269325..1269390 + 66 NuclAT_27 - -
- (1269325) 1269325..1269390 + 66 NuclAT_27 - -
- (1269325) 1269325..1269390 + 66 NuclAT_30 - -
- (1269325) 1269325..1269390 + 66 NuclAT_30 - -
- (1269325) 1269325..1269390 + 66 NuclAT_30 - -
- (1269325) 1269325..1269390 + 66 NuclAT_30 - -
- (1269325) 1269325..1269390 + 66 NuclAT_33 - -
- (1269325) 1269325..1269390 + 66 NuclAT_33 - -
- (1269325) 1269325..1269390 + 66 NuclAT_33 - -
- (1269325) 1269325..1269390 + 66 NuclAT_33 - -
MJ592_RS06245 (1269703) 1269703..1269810 - 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1269859) 1269859..1269924 + 66 NuclAT_35 - -
- (1269859) 1269859..1269924 + 66 NuclAT_35 - -
- (1269859) 1269859..1269924 + 66 NuclAT_35 - -
- (1269859) 1269859..1269924 + 66 NuclAT_35 - -
- (1269859) 1269859..1269924 + 66 NuclAT_37 - -
- (1269859) 1269859..1269924 + 66 NuclAT_37 - -
- (1269859) 1269859..1269924 + 66 NuclAT_37 - -
- (1269859) 1269859..1269924 + 66 NuclAT_37 - -
- (1269859) 1269859..1269924 + 66 NuclAT_39 - -
- (1269859) 1269859..1269924 + 66 NuclAT_39 - -
- (1269859) 1269859..1269924 + 66 NuclAT_39 - -
- (1269859) 1269859..1269924 + 66 NuclAT_39 - -
- (1269859) 1269859..1269924 + 66 NuclAT_41 - -
- (1269859) 1269859..1269924 + 66 NuclAT_41 - -
- (1269859) 1269859..1269924 + 66 NuclAT_41 - -
- (1269859) 1269859..1269924 + 66 NuclAT_41 - -
- (1269859) 1269859..1269924 + 66 NuclAT_43 - -
- (1269859) 1269859..1269924 + 66 NuclAT_43 - -
- (1269859) 1269859..1269924 + 66 NuclAT_43 - -
- (1269859) 1269859..1269924 + 66 NuclAT_43 - -
- (1269859) 1269859..1269924 + 66 NuclAT_45 - -
- (1269859) 1269859..1269924 + 66 NuclAT_45 - -
- (1269859) 1269859..1269924 + 66 NuclAT_45 - -
- (1269859) 1269859..1269924 + 66 NuclAT_45 - -
- (1269858) 1269858..1269925 + 68 NuclAT_17 - Antitoxin
- (1269858) 1269858..1269925 + 68 NuclAT_17 - Antitoxin
- (1269858) 1269858..1269925 + 68 NuclAT_17 - Antitoxin
- (1269858) 1269858..1269925 + 68 NuclAT_17 - Antitoxin
- (1269858) 1269858..1269925 + 68 NuclAT_20 - Antitoxin
- (1269858) 1269858..1269925 + 68 NuclAT_20 - Antitoxin
- (1269858) 1269858..1269925 + 68 NuclAT_20 - Antitoxin
- (1269858) 1269858..1269925 + 68 NuclAT_20 - Antitoxin
- (1269858) 1269858..1269925 + 68 NuclAT_23 - Antitoxin
- (1269858) 1269858..1269925 + 68 NuclAT_23 - Antitoxin
- (1269858) 1269858..1269925 + 68 NuclAT_23 - Antitoxin
- (1269858) 1269858..1269925 + 68 NuclAT_23 - Antitoxin
- (1269858) 1269858..1269925 + 68 NuclAT_26 - Antitoxin
- (1269858) 1269858..1269925 + 68 NuclAT_26 - Antitoxin
- (1269858) 1269858..1269925 + 68 NuclAT_26 - Antitoxin
- (1269858) 1269858..1269925 + 68 NuclAT_26 - Antitoxin
- (1269858) 1269858..1269925 + 68 NuclAT_29 - Antitoxin
- (1269858) 1269858..1269925 + 68 NuclAT_29 - Antitoxin
- (1269858) 1269858..1269925 + 68 NuclAT_29 - Antitoxin
- (1269858) 1269858..1269925 + 68 NuclAT_29 - Antitoxin
- (1269858) 1269858..1269925 + 68 NuclAT_32 - Antitoxin
- (1269858) 1269858..1269925 + 68 NuclAT_32 - Antitoxin
- (1269858) 1269858..1269925 + 68 NuclAT_32 - Antitoxin
- (1269858) 1269858..1269925 + 68 NuclAT_32 - Antitoxin
MJ592_RS06250 (1270238) 1270238..1270345 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1270393) 1270393..1270460 + 68 NuclAT_16 - -
- (1270393) 1270393..1270460 + 68 NuclAT_16 - -
- (1270393) 1270393..1270460 + 68 NuclAT_16 - -
- (1270393) 1270393..1270460 + 68 NuclAT_16 - -
- (1270393) 1270393..1270460 + 68 NuclAT_19 - -
- (1270393) 1270393..1270460 + 68 NuclAT_19 - -
- (1270393) 1270393..1270460 + 68 NuclAT_19 - -
- (1270393) 1270393..1270460 + 68 NuclAT_19 - -
- (1270393) 1270393..1270460 + 68 NuclAT_22 - -
- (1270393) 1270393..1270460 + 68 NuclAT_22 - -
- (1270393) 1270393..1270460 + 68 NuclAT_22 - -
- (1270393) 1270393..1270460 + 68 NuclAT_22 - -
- (1270393) 1270393..1270460 + 68 NuclAT_25 - -
- (1270393) 1270393..1270460 + 68 NuclAT_25 - -
- (1270393) 1270393..1270460 + 68 NuclAT_25 - -
- (1270393) 1270393..1270460 + 68 NuclAT_25 - -
- (1270393) 1270393..1270460 + 68 NuclAT_28 - -
- (1270393) 1270393..1270460 + 68 NuclAT_28 - -
- (1270393) 1270393..1270460 + 68 NuclAT_28 - -
- (1270393) 1270393..1270460 + 68 NuclAT_28 - -
- (1270393) 1270393..1270460 + 68 NuclAT_31 - -
- (1270393) 1270393..1270460 + 68 NuclAT_31 - -
- (1270393) 1270393..1270460 + 68 NuclAT_31 - -
- (1270393) 1270393..1270460 + 68 NuclAT_31 - -
MJ592_RS06255 (1270749) 1270749..1271849 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
MJ592_RS06260 (1272119) 1272119..1272349 + 231 WP_001146444.1 putative cation transport regulator ChaB -
MJ592_RS06265 (1272507) 1272507..1273202 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
MJ592_RS06270 (1273246) 1273246..1273599 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T236968 WP_000170963.1 NZ_CP092702:c1269810-1269703 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T236968 NZ_LR778142:c3420051-3419644 [Escherichia coli]
GTGGTCCTGTGGCAATCTGATTTGCGCGTCTCCTGGCGCGCACAGTGGCTTTCCTTGCTGATTCATGGGCTGGTTGCCGC
TGTTATTTTACTCATGCCCTGGCCGCTCAGTTACACCCCGTTATGGATGGTGTTACTTTCGCTGGTGGTGTTTGATTGCG
TTCGCAGCCAGCGGCGCATTAATGCTCGCCAGGGGGAAATTCGCCTGTTGATGGACGGGCGTTTGCGTTGGCAAGGGCAG
GAGTGGAGCATCGTCAAAGCGCCGTGGATGATTAAGAGCGGCATGATGCTGCGTTTACGTTCTGACAGCGGAAAACGGCA
ACATTTATGGCTGGCAGCTGACAGCATGGACGAAGCCGAATGGCGGGATTTACGGCGGATATTGTTACAACAAGAGACGC
AAAGATAA

Antitoxin


Download         Length: 68 bp

>AT236968 NZ_CP092702:1269858-1269925 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure


Antitoxin

Download structure file

References