Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1838225..1838405 | Replicon | chromosome |
Accession | NZ_CP092547 | ||
Organism | Staphylococcus aureus strain VMRSA-WC083 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | MKI66_RS08795 | Protein ID | WP_001801861.1 |
Coordinates | 1838225..1838320 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1838348..1838405 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MKI66_RS08765 (MKI66_001733) | 1833388..1834038 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
MKI66_RS08770 (MKI66_001734) | 1834119..1835114 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
MKI66_RS08775 (MKI66_001735) | 1835189..1835815 | + | 627 | WP_000669024.1 | hypothetical protein | - |
MKI66_RS08780 (MKI66_001736) | 1835856..1836197 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
MKI66_RS08785 (MKI66_001737) | 1836298..1836870 | + | 573 | WP_000414216.1 | hypothetical protein | - |
MKI66_RS08790 (MKI66_001738) | 1837068..1838080 | - | 1013 | Protein_1731 | IS3 family transposase | - |
MKI66_RS08795 (MKI66_001739) | 1838225..1838320 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1838348..1838405 | - | 58 | - | - | Antitoxin |
MKI66_RS08800 (MKI66_001740) | 1838443..1838544 | + | 102 | WP_001792025.1 | hypothetical protein | - |
MKI66_RS08805 (MKI66_001741) | 1838522..1838683 | - | 162 | Protein_1734 | transposase | - |
MKI66_RS08810 (MKI66_001742) | 1838668..1839078 | - | 411 | WP_001808705.1 | IS21 family transposase | - |
MKI66_RS08815 (MKI66_001743) | 1839620..1840849 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
MKI66_RS08820 (MKI66_001744) | 1840842..1842398 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
MKI66_RS08825 (MKI66_001745) | 1842562..1842696 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | lukD / hlgA / selk | 1832630..1865238 | 32608 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T236521 WP_001801861.1 NZ_CP092547:1838225-1838320 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T236521 NZ_LR595848:c1695661-1695482 [Streptococcus pneumoniae]
ATGCCTATGACACAAAAAGAGATGGTTAAACTCCTTACGGCCCATGGTTGGATAAAGACTAGAGGCGGTAAAGGCTCCCA
TATTAAAATGGAAAAGCAAGGGGAAAGACCTATCACAATCCTTCATGGTAAGCTGAATAAGTACACTGAAAGAGGGATAA
GAAAGCAAGCTGGGTTGTAA
ATGCCTATGACACAAAAAGAGATGGTTAAACTCCTTACGGCCCATGGTTGGATAAAGACTAGAGGCGGTAAAGGCTCCCA
TATTAAAATGGAAAAGCAAGGGGAAAGACCTATCACAATCCTTCATGGTAAGCTGAATAAGTACACTGAAAGAGGGATAA
GAAAGCAAGCTGGGTTGTAA
Antitoxin
Download Length: 58 bp
>AT236521 NZ_CP092547:c1838405-1838348 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|