Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2467680..2467864 | Replicon | chromosome |
Accession | NZ_CP092538 | ||
Organism | Staphylococcus aureus strain VMRSA-WC123 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
Locus tag | MKI57_RS12355 | Protein ID | WP_000482652.1 |
Coordinates | 2467757..2467864 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2467680..2467740 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MKI57_RS12340 (MKI57_002446) | 2463135..2463266 | - | 132 | WP_223197975.1 | hypothetical protein | - |
MKI57_RS12345 (MKI57_002447) | 2463533..2465266 | - | 1734 | WP_000486487.1 | ABC transporter ATP-binding protein | - |
MKI57_RS12350 (MKI57_002448) | 2465291..2467054 | - | 1764 | WP_001064825.1 | ABC transporter ATP-binding protein | - |
- | 2467680..2467740 | + | 61 | - | - | Antitoxin |
MKI57_RS12355 (MKI57_002449) | 2467757..2467864 | - | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
MKI57_RS12360 (MKI57_002450) | 2467998..2468384 | - | 387 | WP_000779360.1 | flippase GtxA | - |
MKI57_RS12365 (MKI57_002451) | 2468652..2469794 | + | 1143 | WP_001176858.1 | glycerate kinase | - |
MKI57_RS12370 (MKI57_002452) | 2469854..2470513 | + | 660 | WP_000831298.1 | membrane protein | - |
MKI57_RS12375 (MKI57_002453) | 2470695..2471906 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
MKI57_RS12380 (MKI57_002454) | 2472029..2472502 | - | 474 | WP_000456486.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T236480 WP_000482652.1 NZ_CP092538:c2467864-2467757 [Staphylococcus aureus]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T236480 NZ_CP092538:c2467864-2467757 [Staphylococcus aureus]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT236480 NZ_CP092538:2467680-2467740 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|