Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF1/- |
| Location | 1936101..1936408 | Replicon | chromosome |
| Accession | NZ_CP092055 | ||
| Organism | Staphylococcus aureus strain USA600 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | AH5611_RS09440 | Protein ID | WP_011447039.1 |
| Coordinates | 1936232..1936408 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 1936101..1936240 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AH5611_RS09400 (1931441) | 1931441..1931701 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| AH5611_RS09405 (1931754) | 1931754..1932104 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| AH5611_RS09410 (1932788) | 1932788..1933237 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| AH5611_RS09415 (1933332) | 1933332..1933667 | - | 336 | Protein_1818 | SH3 domain-containing protein | - |
| AH5611_RS09420 (1934317) | 1934317..1934808 | - | 492 | WP_000919350.1 | staphylokinase | - |
| AH5611_RS09425 (1934999) | 1934999..1935754 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| AH5611_RS09430 (1935766) | 1935766..1936020 | - | 255 | WP_000611512.1 | phage holin | - |
| AH5611_RS09435 (1936072) | 1936072..1936179 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - (1936101) | 1936101..1936240 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (1936101) | 1936101..1936240 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (1936101) | 1936101..1936240 | + | 140 | NuclAT_0 | - | Antitoxin |
| - (1936101) | 1936101..1936240 | + | 140 | NuclAT_0 | - | Antitoxin |
| AH5611_RS09440 (1936232) | 1936232..1936408 | - | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| AH5611_RS09445 (1936558) | 1936558..1936854 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| AH5611_RS09450 (1936912) | 1936912..1937199 | - | 288 | WP_001040261.1 | hypothetical protein | - |
| AH5611_RS09455 (1937246) | 1937246..1937398 | - | 153 | WP_001153681.1 | hypothetical protein | - |
| AH5611_RS09460 (1937388) | 1937388..1941173 | - | 3786 | WP_238762292.1 | phage tail spike protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / chp / sak / hlb / groEL | 1931754..1985005 | 53251 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T235612 WP_011447039.1 NZ_CP092055:c1936408-1936232 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T235612 NZ_LR134311:2684777-2684884 [Escherichia coli]
ATGACGCTCGCGAAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGAAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 140 bp
>AT235612 NZ_CP092055:1936101-1936240 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
