Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-ratA/Fst(toxin) |
Location | 52435..52676 | Replicon | plasmid p1 |
Accession | NZ_CP091905 | ||
Organism | Enterococcus faecalis strain 43-2 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | L5I20_RS15150 | Protein ID | WP_002360667.1 |
Coordinates | 52435..52545 (+) | Length | 37 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 52585..52676 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
L5I20_RS15100 (47526) | 47526..47693 | - | 168 | Protein_53 | peptide-binding protein | - |
L5I20_RS15105 (47827) | 47827..48087 | - | 261 | Protein_54 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
L5I20_RS15110 (48267) | 48267..48947 | + | 681 | WP_001015311.1 | IS6-like element IS1216 family transposase | - |
L5I20_RS15115 (48989) | 48989..49279 | + | 291 | WP_238461556.1 | hypothetical protein | - |
L5I20_RS15120 (49273) | 49273..49497 | + | 225 | WP_002406593.1 | ultraviolet resistance protein UvrA repressor UvrC | - |
L5I20_RS15125 (49558) | 49558..49767 | + | 210 | WP_010822384.1 | hypothetical protein | - |
L5I20_RS15130 (49779) | 49779..50081 | + | 303 | WP_002406176.1 | DUF6440 family protein | - |
L5I20_RS15135 (50509) | 50509..51837 | + | 1329 | WP_211137039.1 | ultraviolet resistance protein UvrA | - |
L5I20_RS15140 (51834) | 51834..52184 | + | 351 | WP_002400993.1 | hypothetical protein | - |
L5I20_RS15145 (52141) | 52141..52353 | + | 213 | WP_002360669.1 | hypothetical protein | - |
L5I20_RS15150 (52435) | 52435..52545 | + | 111 | WP_002360667.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- (52585) | 52585..52676 | - | 92 | NuclAT_0 | - | Antitoxin |
- (52585) | 52585..52676 | - | 92 | NuclAT_0 | - | Antitoxin |
- (52585) | 52585..52676 | - | 92 | NuclAT_0 | - | Antitoxin |
- (52585) | 52585..52676 | - | 92 | NuclAT_0 | - | Antitoxin |
L5I20_RS15155 (52785) | 52785..53075 | + | 291 | WP_049084802.1 | hypothetical protein | - |
L5I20_RS15160 (53179) | 53179..53550 | - | 372 | WP_000049959.1 | replication-associated protein RepC | - |
L5I20_RS15165 (53543) | 53543..54388 | - | 846 | WP_000239313.1 | AAA family ATPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | ant(6)-Ia / aph(3')-III / erm(B) | cylR2 / cylL / cylS / cylM / cylB / cylA / cylI | 1..54858 | 54858 | |
- | inside | IScluster/Tn | ant(6)-Ia / aph(3')-III / erm(B) | - | 30868..48947 | 18079 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 37 a.a. Molecular weight: 4117.92 Da Isoelectric Point: 4.1672
>T235204 WP_002360667.1 NZ_CP091905:52435-52545 [Enterococcus faecalis]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
Download Length: 111 bp
>T235204 NZ_LR134227:2570957-2571064 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 92 bp
>AT235204 NZ_CP091905:c52676-52585 [Enterococcus faecalis]
TAAAAATATGTTATACTAAAGGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGA
TTGCTTTTTTTT
TAAAAATATGTTATACTAAAGGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGA
TTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|